SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003203 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003203
Domain Number 1 Region: 271-466
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000525
Further Details:      
 
Domain Number 2 Region: 20-155
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-28
Family SH2 domain 0.000000302
Further Details:      
 
Domain Number 3 Region: 211-265
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003203   Gene: ENSFALG00000003058   Transcript: ENSFALT00000003216
Sequence length 466
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603193.1:694984:787835:-1 gene:ENSFALG00000003058 transcript:ENSFALT00000003216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTSHWPGADVSDTDEYRPPVWKSYLYQLQQEAPHPRRITCTREVENRPKYYGREFHGMI
SREEADQLLSVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIH
DLVTDGLITLYIETKAAEYISKMTINPIYEHIGYTTLNREPAHKKHMPALRDEHDGKEST
GEDEVAEKRFTSVRRREWLKARQALPLFRKINFSFKVHTFRGPHWCEYCANFMWGLIAQG
VKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHFTKRPMVVDMCIREIE
SRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIP
LITYDAYPKFIESAKTADPDEQLEILHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLM
SAENLGIVFGPTLMRAPELDAMAALNDIRYQRLVVEMLIKNEDILF
Download sequence
Identical sequences U3JK99
ENSFALP00000003203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]