SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003505 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003505
Domain Number 1 Region: 510-748,782-849
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.9e-55
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 6-91,215-242
Classification Level Classification E-value
Superfamily EF-hand 3.1e-40
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 
Domain Number 3 Region: 218-330
Classification Level Classification E-value
Superfamily EF-hand 1.33e-21
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 4 Region: 311-380
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0035
Further Details:      
 
Domain Number 5 Region: 380-448
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003505   Gene: ENSFALG00000003364   Transcript: ENSFALT00000003519
Sequence length 875
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603271.1:408830:428129:1 gene:ENSFALG00000003364 transcript:ENSFALT00000003519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDGMWISLSPAEFAQLQQYTDYSTKKLKDVLEEFHGDGVLSRYNPEQPIDYEGFCLFMK
TYLEADVPEELCQHLFTSFKRKICQASPESQQQSPGVSQHSSLGINGKTLRGALGRHTPE
PKGCQSNTAEPQPASLTLASIPSASPSWSRSSSQKSTTGTASAHNSSGSSKISSVSVLSP
QSPGTRSTEKRLPFSLRKGPSSLKATPPPPPTPVAQVVHLKDIVCYLSLLERGRAEDKLE
FMFRLYDTDGNGVLDSSELDRIINQMVHVAEYLEWDSTELKPILKDMMEEIDYNHDGTVT
LEEWIRGGMTTIPLLVLLGMETNVKDDGQHAWRLKHFKKPAYCNFCRTMLLGVRKQGLCC
SFCKYTVHERCVSKDIASCISTYVKSKRNTSVMQHTWIEGNSPAKCDRCHKSIKCYQGIT
GLHCVWCQVTLHNKCASHVKPECDGGPLRDHILLPSSICPVVLDRQSHCRRSESDSPAST
SPEDSQGFKFNSTTVDGQGLQISPQPGTHPLLVFVNPKSGGRQGERVLRKFHYLLNPRQV
YNLDRGGPTPGLNFFRDTPDFRVLACGGDGTVGWILDCIDKANLVKHPPVAVLPLGTGND
LARCLRWGGGYEGGNLMKVLKDIEHSTEVMLDRWHIDIIPTDREANGDPVPSTIINNYFS
IGVDASIAHRFHIMREKHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDYVEVECDGTL
LDLSNTSLEGIAVLNIPSMYGGSNLWGETKKQRGYNRLGKKAPEKLPGTVVTDAKELKFC
VQDLSDHLLEVVGLEGAMEMGQIYTGLKSAGKRLAQCSSVIIRTSKLLPMQVDGEPWMQP
SCTVKITHKSQVPMLLGPPQKSSFFFLKRRNRTRD
Download sequence
Identical sequences U3JL51
XP_005050827.1.66865 ENSFALP00000003505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]