SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003928 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003928
Domain Number 1 Region: 246-335
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-34
Family ets domain 0.00000758
Further Details:      
 
Domain Number 2 Region: 117-218
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.6e-29
Family Pointed domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003928   Gene: ENSFALG00000003770   Transcript: ENSFALT00000003946
Sequence length 337
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603249.1:3678990:3689125:1 gene:ENSFALG00000003770 transcript:ENSFALT00000003946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSASPGLSALPAGRLAWPEPALLPPPRDPHPRSWGCPESPSPPSTPEQPLPAFCLHYFD
MVYPEDTAWAAKGAGEASHSSGQGGREEARKEPEQCPIIDSQGLGLGPEGDLQDSLHLEE
HSLEQVQSMVVGEVLKDIETACKLLNIAADPADWSPGNVQKWILWTEHQYRLPQIGKSFQ
ELSGKDLCAMSEEQFCQRSPACGDILHAHLDIWKSAAWMKEKAAPGDVRYCGGDSSWADS
EVDSSCAGQPIHLWQFLKDLLLKPHNYGRFIRWLNKDKGIFKIEDSAQVARLWGIRKNRP
AMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPV
Download sequence
Identical sequences U3JMC4
XP_005059528.2.66865 ENSFALP00000003928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]