SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000004090 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000004090
Domain Number 1 Region: 171-253
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000248
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000275
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000004090   Gene: ENSFALG00000003919   Transcript: ENSFALT00000004109
Sequence length 448
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603203.1:2289941:2297499:1 gene:ENSFALG00000003919 transcript:ENSFALT00000004109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEDETLGGETERAKVEPCATSALGRQISVSEFLCHCCYDILINPTTLNCGHSFCRHCLA
LWWVSSKKNECPECREKWEGFPKVNILLRDVIEKLFSDAIEQRKEDIQQNSDVARSLATF
QKYGNDQMPTVSNTGRINPQGGFFSGVLTALTCVAVVLLGYHWSSREFEDDLLVHKPVAR
WTAEEVIFWLEQLGPWASHYKERFLLEKVNGRLLLTLTEEDFTKEPYSVENSNHRRAIMA
ELERVKTLGVKPPQNLWEYKAINPGKSLFLLYALKSSPRLSMLYLYLFDYAEAFLPFMHT
ICPMQEDKYEDTVTKLLDLKDPSWRQWREFTVKYLFLPYQLIAEFAWDWLDVHYWTSRFI
IVNAMLLSVLELFSFWRLWSRGELKTIPHRMWRHFWKVSTQGLFVAIFWPFIPQFVCNCL
FYWALYFNPVINIDLVVTEIRRLETQVQ
Download sequence
Identical sequences U3JMT6
XP_005054116.1.66865 XP_005054117.1.66865 ENSFALP00000004090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]