SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000004549 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFALP00000004549
Domain Number - Region: 9-52
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0102
Family SAM (sterile alpha motif) domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000004549   Gene: ENSFALG00000004369   Transcript: ENSFALT00000004573
Sequence length 497
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603193.1:10014312:10040045:-1 gene:ENSFALG00000004369 transcript:ENSFALT00000004573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALPRTLGELQLYRILQKANLLFYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMAS
KPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPAWLGISCSSYERNSSS
REPHLKIPKCAATTCVQSVGTSKSDVGSLSLQSSSEPRLWQGHHTTESEHSLSPADLGSP
ASPKENSETLDAAAALSVAECVERMVPSLPKSDSNEVKELLKTNKKLAKMIGHIFEMSDD
DPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALA
RQISREVTYKYTYRTTKSKCGERDELSPKRIKIEDGYPDFQDTVQLYQQDKMPLALAKGK
SEDPTALNSQSEKVMAKQMEFLCNQAALERRLSTGCYRQNSEEHSPNGMSLDNADGQGER
PLNLRMSNLPSRQMQHISLDGEQHVGKSLCSDLIRLYPSGEAKSQSSEGLGILKDFPHSA
FNNIERKVIKTEPEDTR
Download sequence
Identical sequences U3JP45
ENSFALP00000004549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]