SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000004773 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000004773
Domain Number 1 Region: 612-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-82
Family Protein kinases, catalytic subunit 0.000000016
Further Details:      
 
Domain Number 2 Region: 30-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-60
Family Ephrin receptor ligand binding domain 0.0000147
Further Details:      
 
Domain Number 3 Region: 330-533
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-30
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 903-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.2e-19
Family SAM (sterile alpha motif) domain 0.0013
Further Details:      
 
Domain Number 5 Region: 259-324,368-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000506
Family Growth factor receptor domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000004773   Gene: ENSFALG00000004553   Transcript: ENSFALT00000004797
Sequence length 971
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603259.1:571759:608193:-1 gene:ENSFALG00000004553 transcript:ENSFALT00000004797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AERCSGGMELSLGLLLLGALLAPEAHGKEVDLLDTSTAQGELGWLPDPPEVGGQWSEVQQ
MINGTPIYMYQDCSVLSEGDTDHWLRTNWIYRGEAASRIYVELKFTVRDCKSFKGEVVTC
KETFNLYYMESEQDVGIQFRRPLFTKLNTVAADRSFTSRDIESGAMQLNTEVCPIGKLSR
RGFYLAFQNSGACVAMVSVRVYYKTCPEAVRGLARFPETLAGSEGLTEVPGVCVEYAAEE
VGSPPRMHCSTDGEWLVPVGRCLCAVGFEEVDGSCVACQRGFYRHSLDAKRCLKCPPNSL
SNESGATTCSCNAGFYRAPSEGQNIACTRPPSAPRNVSFSLLGTQLSLWWQPPSDHGGRK
DLTYTVFCQRCHFLSCEPCEAGVVFSPSASGLTKPAVDVDGLEAYTNYTFTVEAHNGVSG
MGPSPQRTAPAVWVSVGHAAPVTVSQFILTQRDDSSLSVSWLAPRQRSRTSVEYEVMFFE
KGEEARYTVKHLLEPNVTLRDLQPDTAYLLRVRSITPLGPGPYSPEQEFRTLPPDTGALS
GGVIVSIIFGVFLFIALILGLFMFWRKRARRRHARPDYSTSGFEREKVWLKPYVDLQPYD
DPSRGVLEFTKELDVSCVTMENVIGEGEFGEVYRGSLRLSGKERIVVAIKTLKSTYSDSQ
WWNFLREATIMGQFNHPNIVRLEGVVTKRRPMMIITEYMENGALDTFLRENEEKFSPVQL
VSMLQGIASGMTYLSEHNYVHRDLAARNILVTRSLQCKVSDFGLSRILENDAEGTYETKG
GKIPIRWTAPEAIAHRIFTSASDVWSFGIVMWEVLSFGDKPYGHMTNQEVMKSLEDGYRL
PPPVDCPSILYELMKSCWSHDRMRRPHFQEIRAQLQHFISSPQLLRPVADFDPRVTLRLP
SCSGSDGIPYRSIPEWLESIRMKRYISNFRTAGLDTMESILELTAEDLKQMGVSLPGHQK
RILCSIQGFKE
Download sequence
Identical sequences U3JPR9
ENSFALP00000004773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]