SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000005132 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000005132
Domain Number 1 Region: 509-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-56
Family Protein kinases, catalytic subunit 0.0000106
Further Details:      
 
Domain Number 2 Region: 262-314
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00018
Further Details:      
 
Domain Number 3 Region: 169-176
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000005132   Gene: ENSFALG00000004926   Transcript: ENSFALT00000005157
Sequence length 843
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603226.1:731529:758577:-1 gene:ENSFALG00000004926 transcript:ENSFALT00000005157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVKLIDYIHRQRQCKLSVPLSDRTAELNSYPRFHDWLDIVNVRKEVVQRIPEELTLDAL
LEMNESKVKETMKRCGARDEECSRLNGALSCLRKVTESGWGRAEAQGDHCQVEGARRACS
ESSVPSRRAGTNAAPCDRRGAEGRCARGPARAPAPPPPPPPPPPPPPPPPPPPPPPPPPV
PGRPRTPHSITVTPPATPQPRRRHRPKPPRTPPPPCRKVFQLLPSFPTLTRSKSHESQLG
NRIDEVPPIKFELSQGSPQMVRRDFGLAVTHRFSTKSWLSQICQVCQKSMMFGVKCKYCR
LKCHNKCTKEAPACRISFLPITKIRRTESVPSDINNPVDRPTEPQFGTLPKALTKKEHPP
AINHLDSSSNPSSTTSSTPSSPAPFQSSNPPSATPPPNPSPMGQRDGRFNFPAAYYLQHR
QQFVFPVYRRLKCKRCIITVSTFPEIPSPAQTAQLPETAADTNAAQQPGTGGGAREAQVE
EPEASKSEAEDDEDEVEDLPSRRPHLPGMIYRKPSQTSVYLQEWDIPFEQIQLGDPIGQG
RWGKVYKGKWHGEVAIRLLEIDGNNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHL
AIITSFCKGRTLHSFVRDPKISLDINKTRQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYD
NGKVVITDFGLFGISGVVQEGRLRRENELKLPHDWLCYLAPEIVREMAPGKDEDKLPFSK
AADIYAFGTVWYELQAREWPFRSQPAEALIWQIGSGQGVRQVLATASLGKEVNEILSACW
AFDLSERPSFTVLMEMLEKLPKLNRRLSHPGHFWKSADINSSKVVLRFERFGLGILEASN
PKL
Download sequence
Identical sequences U3JQS8
ENSFALP00000005132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]