SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000005686 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000005686
Domain Number 1 Region: 33-194
Classification Level Classification E-value
Superfamily L domain-like 2.99e-30
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 2 Region: 572-631
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000119
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 670-718
Classification Level Classification E-value
Superfamily RING/U-box 0.00000177
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000005686   Gene: ENSFALG00000005450   Transcript: ENSFALT00000005713
Sequence length 725
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603316.1:1462886:1493257:-1 gene:ENSFALG00000005450 transcript:ENSFALT00000005713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFSRKKKPSEDARKRLEYQMCLAKEAGADDTLDISRCELSEVPYGAFATCKVLQKKVL
IIHTNNLTSLVPKSCSLLSLITVKVLDLHDNQLASLPADIGQLTALQVLNLERNLLKSLP
QSIGDLAQLQILNVKGNKLRELPGSVSGLRSLRALDVSGNELQELPRGLAHIPTLQETLT
LDACAMTYPPPEICSAGTEAIQQFLCKECGIAYYPPSQYVLPTLESDGGGTSVDGVDRTV
EKYLEEESKWQNKFLDYEKRKERKAQEKLEFERRLNLGQREQALLQQLSSHKDEILQTVR
EEQQRLQQGLSKHQRYLEEERLKLLQQLKDTEQGTATRIQKLLEDNQRQKRSSDILKSLE
NERIRMEQLMAITQEETEQLRRREVASAMQQMLAETYKNKLLQMTSESRRQDLVSQACSS
LAEMDQKFQQILAWQQLDQNKAVSQILQQIEMQKAAFEALQVKKDLTHRQIRNQIKLIET
ELLQLTQLELKRQELDTETLQELVTEQRRALSCLLQQLLKEKKQREEELQQILLEMEAKS
ETKQENYWLIQYQRLLNQKPLSLKLQEKGLEQQLVTLLLELSADQYVPVFAHHRISLEML
GTMSASDLEKLGVTEAGLQRAILSRAQEILAVATTIPELRRAEDSEVPAAPEPSAPPEEP
PSPAAPALQRDEKRSECVVCMEQEPQMIFLPCGHVCCCQRCCERLHSCPLCRQDIAQRIR
IFRSA
Download sequence
Identical sequences U3JSD2
ENSFALP00000005686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]