SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006002 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006002
Domain Number 1 Region: 515-782
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-81
Family Protein kinases, catalytic subunit 0.0000216
Further Details:      
 
Domain Number 2 Region: 352-470
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-31
Family Pleckstrin-homology domain (PH domain) 0.0000128
Further Details:      
 
Domain Number 3 Region: 46-118
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.47e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 192-250
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006002   Gene: ENSFALG00000005728   Transcript: ENSFALT00000006029
Sequence length 841
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603186.1:7810713:7933445:-1 gene:ENSFALG00000005728 transcript:ENSFALT00000006029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKSAADIQEGDLVEVVLSASATF
EDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGV
RKRRLSNVSLTGLSTIRTVSAEPSPSVTDEALLSPVSPGYEQKTPSESYTGREKRSNSQS
YIGRPIQLDKILLSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKR
CAPKVPNNCLGEVAINGDLLSPGAESDVVMEEGSDDNDSERNSGFIDDMEESMAHDSEMS
MAGCHSDNGEMQDTDLDHDESNRMISPSTSNNIPLMRVVQSVKHTKRRSSTVMKEGWMVH
YTSKDTLRKRHYWRLDSKCITLFQNDTGSKYYKEIPLSEILSLEPAKTFSLLPQGANPHC
FEISTANIVYYVGENIDNLSSVPLNNSVICSGVGIDVARMWEMAIQHALMPVIPKGASTG
SGPSLHRDISISISVSNCQVQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAI
KIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMIL
SSEKGRLPERITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFA
RIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHD
QIQNAAFMYPPNPWKEISLEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLREL
ECKMGERYITHESDDSRWEQYSEEHGLQYPAHLISPSANHNENTKLEETEMKALSERVSI
L
Download sequence
Identical sequences U3JT98
ENSFALP00000006002 XP_005047325.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]