SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006258 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006258
Domain Number 1 Region: 21-98
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000658
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006258   Gene: ENSFALG00000006006   Transcript: ENSFALT00000006286
Sequence length 103
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603224.1:4928388:4937741:1 gene:ENSFALG00000006006 transcript:ENSFALT00000006286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPMLTVDMENKENGSLDVKNSLENGRPLDPADWAVTDVVNYFKTAGFEEQANAFQEQEID
GKSLLLMTRNDVLTGLSLKLGPALKIYEYHVKPLQTQHLKNNS
Download sequence
Identical sequences U3JU04
ENSFALP00000006258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]