SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006457 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006457
Domain Number 1 Region: 7-96,175-208
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000323
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 115-174
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000068
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006457   Gene: ENSFALG00000006189   Transcript: ENSFALT00000006486
Sequence length 243
Comment pep:novel scaffold:FicAlb_1.4:JH603182.1:7552418:7575872:1 gene:ENSFALG00000006189 transcript:ENSFALT00000006486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGNLPESRLEGWLSVPNKGNIRRHGWKKQYVVVSSKKILFYNDEKDKDQSNPSMVLDID
KLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDLEVEPVQPAEKTNFLNHKGHEF
IPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEELIAPCKVSYDVTS
ARDLLLLASCQDEQKKWVTHLVKKIPKTPPSTFVRASPRTLSTRSSANQSFRKVVKNTSG
KTS
Download sequence
Identical sequences U3JUK3
ENSFALP00000006457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]