SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006552 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006552
Domain Number 1 Region: 916-1058
Classification Level Classification E-value
Superfamily TNF-like 6.75e-27
Family TNF-like 0.0018
Further Details:      
 
Domain Number 2 Region: 234-345
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 0.0000484
Family RalF, C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000006552
Domain Number - Region: 562-772
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000191
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 516-576
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0032
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006552   Gene: ENSFALG00000006279   Transcript: ENSFALT00000006581
Sequence length 1063
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603182.1:8714766:8747286:1 gene:ENSFALG00000006279 transcript:ENSFALT00000006581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSPGPAPPSGWALPLLLALGAAGLGHGSPHLPYSRPGSRSKNWCAYIVNKNVSCSVLD
GTESYVQAQYKCAWNQFPCEPTLVYRTSFRPRYTVAYKTVTELEWRCCPGYRGEDCREGP
AEKPNTARRPATPARAAVKKGTDAEPTEAPEPPPYEKRMQFLEDELFRLTRSVIELQSSV
AGVNENLKLTVQEDASKMLVTWLNNLYDRPEPDSAVGGETDTIQLPGLLNNKDQKDPFID
FEMEDIKAELAEVKEALKMRNDELEELHGKVKGYEGQLKQLQEAAQGPTITMPRDNIYQD
YIDSKFESLRQEIIEGFEKKMTDLKNSCEYRLEDIQQQYDDSENNCAGIIDVIRGKENDL
RKEINALRTQIPSNNSSCCKKGEGNGSDQQMEDLDKKIDRIMEAQRILNVRIDNEIIRLS
TPDLEDVFGERLEELDARMNITERNAEEHCFYVEETLRGAIAAEVDELRDLFDHKLRALE
VRLGGTILEIANATDPDGMFVNPEPILPSDAGFANEQFTAEMNFVKDKLLSLEQLCGQKC
QSAPRGAEDLQKKLENCNDKYNHLLLKTENNSVLLQSLNSSLNEKLNSIKGNQRDIQKMQ
RDVRVFRYNLNAIDKDMKNLQDGLSSCREQLLGVNSTCRKTQRGVFRKIDQMQRTFANQT
AHSSDHCCSEMRERLEQLNDHMLNDLSKCKEKTQGVQEGVSDVESRVSHVEKVCGKLDSV
SDSLQNIKEGLNKHVSSLWNCIREMNGTIASHSTDIAGLKNSVQQFHSQVSKITADIEGV
LKSQPDTRRPEVPPLQPRPGISLLPSRPRIQPPRHRMPPLPPQPRPPPRPALPGSAAVPV
PLPPGTTGVILETGEAGPPGTALMSGRGRLRSAGGQAGQSTVPIAEGYAGAPGYPKPSPS
PTDSQGPASAAVPSLVSFSAGLTQKPFSSDVGVVHFNKVLVNDGDYYNPKTGIFTSPYEG
RYLITAVLAPERDEYVEAVLSVSNASVAQLHTAGYRRELLEYHKPYSGKQTCGGPGTFHL
VLHLKAGDEVNVVVTGGKLAYTDSDEMYSTFSGVLLYPSISHV
Download sequence
Identical sequences U3JUU8
XP_005042007.1.66865 ENSFALP00000006552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]