SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006755 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006755
Domain Number 1 Region: 26-358
Classification Level Classification E-value
Superfamily ARM repeat 1.58e-26
Family Plakophilin 1 helical region 0.085
Further Details:      
 
Domain Number 2 Region: 468-596
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000000405
Family Toll/Interleukin receptor TIR domain 0.0064
Further Details:      
 
Domain Number 3 Region: 392-452
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000565
Family SAM (sterile alpha motif) domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006755   Gene: ENSFALG00000006472   Transcript: ENSFALT00000006784
Sequence length 630
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603226.1:4856998:4865741:-1 gene:ENSFALG00000006472 transcript:ENSFALT00000006784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSEVFRLVEEAWGMPAVGRDVAKVLCDVIRLEGGLDLLLNLLYTAELETKCQAGKLLEQI
LVAENRDRIARIGLGVILNLAKERDVPQLAQSVSGILEHMFKHSEETCFQLISDGGLDSI
LYWCRWTDPAVLRHCAMALANCAMYGGQANQRLMIEKKAAEWLFPLAFSKDDELIRLHAC
LAVTVLATNKEIEKEVERSGTLALVEPFIASLDPERFAREMLGSSDNIQGRTAQDLQRLV
PLLDSSRLEAQCVAAFYLCTEAAIKARQKKTQIFSEIGATQSLKRIVCYSTSSTTSALAK
KVLRMIGEEVPRRILPTVPNWKSCEVQTWLQQIGFNKYCQRFLDHQVDGDILLRLTEQEL
QKDLGMDSSITRKRFFRELTELKTFANYSTCDRSNLADWLGGIDPKFRQYTYNLLTCGID
RNFLHRVTEQQLQEDCHIHTGFHRVRILTAARETLHSPITLQTTSNGTDVFISYRRSTGS
QLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVLSARNFVLVLSPNALDKCMEDPE
CKDWVHKEIVTALNSGKNIVPVTDHFEWPDPETLPKDMRAVLKFNGIMWSHEYQEATIDK
IIRFLQGRSSRDSSAGSENGLDCLHSLGQS
Download sequence
Identical sequences U3JVF1
ENSFALP00000006755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]