SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000007077 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000007077
Domain Number 1 Region: 24-251
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.7e-65
Family Ecto-ART 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000007077   Gene: ENSFALG00000006787   Transcript: ENSFALT00000007108
Sequence length 294
Comment pep:novel scaffold:FicAlb_1.4:AGTO01003137.1:1661:2573:1 gene:ENSFALG00000006787 transcript:ENSFALT00000007108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMAPLAQTLALLAMAVATIAIKKVPLDMARKSFDDQYLTCADNITEKLPELRSTEFLKNV
KFAQAWHEAETAWQARGSPMSQDLSQDQTIALLIYTNGTLYSSFNEAVREAGSSRKKYHK
NFHFKTLHFLLTRVLQRLRQLWEPKNCQNVFRGVSGVQFNVKVGDEVRFGQFASTSQSPT
VAEQRANDTMFHVYTCHGADIQRFSSKPYEKEVLVPPFETFKVTNVTWEGRKMNITLHST
GNFSKYNCEWLRGDTGGHSLGGWDDCEVMAQGDIPWGHCEVTSRGIFPGGTGML
Download sequence
Identical sequences U3JWC3
ENSFALP00000007077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]