SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000007971 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000007971
Domain Number 1 Region: 8-187
Classification Level Classification E-value
Superfamily Ankyrin repeat 9e-39
Family Ankyrin repeat 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000007971   Gene: ENSFALG00000007634   Transcript: ENSFALT00000008004
Sequence length 192
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603177.1:11542433:11547915:-1 gene:ENSFALG00000007634 transcript:ENSFALT00000008004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITIIFSLQPICQAAYSNDFNKVHLLLEGNSNYLNVQDSFSGDTPLICACRQGNNRIVNYL
LRKHADVNLRNKKDRTCLHYAVRKRFTFLDYVLIIILMPVMLIGYLLMVSKTKQNEHLVK
TLLRAGVDVNAADSSGSTALHYACEMKNQAVIPLLLEAHADTSVKNQDGETPLDIARRLQ
FHNIESMVRKDS
Download sequence
Identical sequences U3JYW7
ENSFALP00000007971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]