SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000008130 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000008130
Domain Number 1 Region: 269-403,430-568
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.32e-66
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 3-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-57
Family Ankyrin repeat 0.0000561
Further Details:      
 
Domain Number 3 Region: 892-1095
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.9e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0023
Further Details:      
 
Domain Number 4 Region: 578-726
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-37
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 5 Region: 811-872
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000193
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000008130   Gene: ENSFALG00000007782   Transcript: ENSFALT00000008163
Sequence length 1105
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603177.1:12311274:12333818:1 gene:ENSFALG00000007782 transcript:ENSFALT00000008163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFGRKDVVEYLLQSGANVHARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYT
PLHEAAIKGKTDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESAR
SGNEEKMMSLLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLV
PLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLL
NCHNKSTIDLAPTPQLKERLAYEFKGHSLLQAARESDVARIKKHLSLETVNFKHPQTHET
ALHCAAASPYPKRKQVCELLLRKGANINEKTKDFLTPPHVASEKAHNDVVEVVVKHEAKV
NALDNLGQTSLHRAAHCGHLQTCRLLLSSGCDPSIVSLQGFTALQMGTESVQQLLQEGIP
LGNSDADRQLLEAAKAGDVDTVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLL
QHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYE
ICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLCS
PDNVNCRDTQGRHSTPLHLAAIPAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYG
HVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLD
LVTADDVSALLTAAMPPSALPTCYKPQVISVSQTTGSAADSLSSVPSSPSSLSAASSLDN
LSSSFSELPSVVGTNCAEGATVLEKKEVSGVDFSINQFVRNLGLEHLIDIFEREQITLDV
LVEMGHKELKEIGINAYGHRHKIIKGVERLISGQQVTGLNPYLTLNTSASGTILIDLSTE
DKEFQSVEEEMQSTVREHRDGGHAGGVFNRYNILKIQKVCNKKLWERYTHRRKEVSEENH
NHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGC
PIHKDRSCYVCHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVI
YRGEQAYPEYLITYQIMKPEATTEA
Download sequence
Identical sequences U3JZC6
ENSFALP00000008130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]