SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000008526 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000008526
Domain Number 1 Region: 583-884
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.01e-81
Family Protein kinases, catalytic subunit 0.000000000301
Further Details:      
 
Domain Number 2 Region: 1-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-71
Family Ephrin receptor ligand binding domain 0.000000336
Further Details:      
 
Domain Number 3 Region: 297-502
Classification Level Classification E-value
Superfamily Fibronectin type III 5.46e-41
Family Fibronectin type III 0.000082
Further Details:      
 
Domain Number 4 Region: 880-953
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.34e-22
Family SAM (sterile alpha motif) domain 0.00011
Further Details:      
 
Domain Number 5 Region: 224-294,345-350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000141
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000008526   Gene: ENSFALG00000008182   Transcript: ENSFALT00000008564
Sequence length 956
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603178.1:10772861:10803012:-1 gene:ENSFALG00000008182 transcript:ENSFALT00000008564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKWVTSELAWTTHPETGWEEVSGYDEAMNPIRTYQVCNVREANQNNWLRTKFIQRQDV
QRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYESDTDSASANSPFWMENPYIKVDTIAP
DESFSKLESGRVNTKVRSFGPLSKNGFYLAFQDLGACMSLISVRAFYKKCSNTIAGFAIF
PETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEWMVPVGACTCAAGYEPTMKDT
QCQACGPGTFKSKQGEGPCSPCPPNSRTTSGAAMVCTCRNGFFRADTDPADSACTSVPSA
PRNVISNVNETSLGLEWSEPQDTGGRDDLLYNVICKKCSVERRLCTRCDDNVEFVPRQLG
LTERRIYISNLMAHTQYTFEIQAVNGISNKSPYPPHFASVNITTNQAAPSAVPTMHLHSS
TGNSMTLSWTPPERPNGIILDYEIKYSEKQGQNDGIANTVTSQKNSVRLDGLKANARYMV
QVRARTVAGYGRYSLPTEFQTTAEGGSTSKTFQELPLIVGSATAGLVFVIVVVVIAIVCF
RKQRNNTDPEYTEKLQQYVTPGMKVYIDPFTYEDPNEAVREFAKEIDISCVKIEEVIGAG
EFGEVCRGRLKLPGRREIFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIHLEGVVT
KSRPVMIITEFMENCALDSFLRLNDGQFTVIQLVGMMRGIAAGMKYLSEMNYVHRDLAAR
NILVNSNLVCKVSDFGLSRFLEDDPADPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVW
SYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLR
PKFAQIVNTLDKLIRNAASLKVIASVQSGISQPLLDRTVPDYTTFTTVGDWLDAIKMGRY
KENFVNAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences U3K0H2
ENSFALP00000008526 XP_005051284.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]