SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000009047 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000009047
Domain Number 1 Region: 33-263
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.3e-60
Family Ecto-ART 0.000093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000009047   Gene: ENSFALG00000008675   Transcript: ENSFALT00000009086
Sequence length 303
Comment pep:novel scaffold:FicAlb_1.4:JH603220.1:6708309:6711494:1 gene:ENSFALG00000008675 transcript:ENSFALT00000009086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPPLLLLLLAGTPAPSARRHRRERDSDIREIALSMVPNSFDDQYQHCRLKMLRALPAL
NRSEFVLSSPYAEAWGKAAALWNSRAWPGSSQGSLLRPEQAIALLAYTMEERLYVEFNRA
VRRVGRSRREYLNNFHFKVLHFLLTGALRALRGAHSHPRCLHVFRGVDRIRFTARPGQIV
RFGQFASSSLLRNVSDFYGTTTTFEVHTCHGADIRRYSIYPEEEEVLIPPYETFNVTGVT
QQGDEVLIQLRSHGVHSKYNCAWFRGDTSTSRPKASPGRSIPRAPPGLTGLLLAALAAVT
STP
Download sequence
Identical sequences U3K1Z3
ENSFALP00000009047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]