SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000009211 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000009211
Domain Number 1 Region: 325-528
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.32e-49
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000586
Further Details:      
 
Domain Number 2 Region: 183-322
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 9.55e-41
Family Domain of poly(ADP-ribose) polymerase 0.0000855
Further Details:      
 
Domain Number 3 Region: 39-153
Classification Level Classification E-value
Superfamily WGR domain-like 3.53e-35
Family WGR domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000009211   Gene: ENSFALG00000008829   Transcript: ENSFALT00000009250
Sequence length 530
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603227.1:4289831:4294847:1 gene:ENSFALG00000008829 transcript:ENSFALT00000009250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRQASSSKQPNSREKKLKVGEEEDTWSSTLATLKTAAKEKPPATIDGHCPLSTAPGA
RVYEDYDCTLNQTNISANNNKFYIIQLLEHDGAYSVWSRWGRVGEVGQSKLMPCASLEAA
KKDFEKKFREKTKNSWAARENFIAQPGKYTLIEVQPGAGQEVEVALRVDAVDGGKVCKQR
VLPCTLDQATQDLVSLIFSSDMFRDAMQTMNIDVKKMPLGKLSKQQIARGFEALEELEAA
LKEQPPQATRLEELSSRFYTIVPHNFGRARPPTINSPDLLRAKKDMLLVLADIELAQSLQ
AQKMKEEEEEEKQVPHPLDQDYALLCCQLSLLDPASREYQLINTYVTETGYNLRILNIWQ
VARDGEEERFKAHDLLEHRRLLWHGTNVAVVAAILKSGLRIMPHSGGRVGKGIYFASENS
KSAGYVGCTSKRVGIMFLTEVALGKPYRITRDDPTLCQPPAGYDSVVACGRTEPDPAQDE
EVLLDGKKVLVCQGKPIPMAAYKDSSFSQSEYLIYQESQCRIRYLVQLCF
Download sequence
Identical sequences U3K2F7
XP_016156963.1.66865 XP_016156964.1.66865 XP_016156965.1.66865 ENSFALP00000009211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]