SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000009454 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000009454
Domain Number 1 Region: 429-610
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.11e-49
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0074
Further Details:      
 
Domain Number 2 Region: 304-394
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000759
Family WWE domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000009454
Domain Number - Region: 122-145
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000759
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 238-281
Classification Level Classification E-value
Superfamily WWE domain 0.0157
Family WWE domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000009454   Gene: ENSFALG00000009061   Transcript: ENSFALT00000009494
Sequence length 615
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603289.1:1621063:1637486:-1 gene:ENSFALG00000009061 transcript:ENSFALT00000009494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPAAAAEAEVAVVVATSPVRLCPEHVAGCPGQCGQLHLCKYHLKGFCRNQVARKGCRFV
HDFHSEHNLRVLKQYGLENLSRDELCQLLLQNDPSLLPEVCLHYNKGDGLYGSCSFKTSC
SKLHVCQYFLRGQCRFGSSCKRSHDLLNPECFEKLERQGMSSDIIKKLPSTYRNMYDIKN
GNRNMNDTEDAKSCKDRKPSTGQDSSATKDSESEQICLYHLYRSCGFKEKCIRTHFHLPY
RWQYSEGNTWKDFTNMEEIEKAYCDPKNVRTNVSHNTVMKICVRFHDMYCGLLKVRRLST
ASSVTKPPHFILTTEWIWYWKDEYDKWQEYGKQDDLHAAATVSSDDLEKAYLAESSPKLT
FKAGRHEYEINFVSMMQKNIRYRTERKICRRPKFVSQADVEKTRARGVKHTEGFKNIPAH
WDKSALPELGFKLIELDYSSEEYNKVKMDFQRTMPRAAIKKICRVQNPSLWELYQWQKDL
MQKSNGGKAPDERFLFHGTSKKDIEAICQQNFDWRICGLHGTVYGKGSYFARDASYSDNY
CGADSYTKTMFLARVLVGEFTLGSSDYVRPPMKDSQNFYDSCVNNYSNPSIFVIFEKQQI
YPEYLIEYQTSARFL
Download sequence
Identical sequences U3K350
ENSFALP00000009454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]