SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010050 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010050
Domain Number 1 Region: 535-645,679-731
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.94e-29
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010050   Gene: ENSFALG00000009616   Transcript: ENSFALT00000010090
Sequence length 751
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603210.1:740158:748533:-1 gene:ENSFALG00000009616 transcript:ENSFALT00000010090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWTDDDSDGDNESEEFLYGVQGTCAADLYRHPQLDADIEAVKEIYSENAVAVREYGTIDD
VDIDLHVNISFLDEEVATAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKEGFGL
GLQLKKILGMFTSQQWKHLSNDFLKTQQEKRHSWFKTSGTIKKFRAGLSIFSPIPKSPSF
PVIQDSVLKGKLGIPEPRVNRLMNRSVSCMVPPRLGVCFSLPLPRAPLGSDRLLWGAETP
HGVGGAPAGFLVPTFGEPGLAVGATGIFPPLWVLHPCCARGYWHVGGPAVPGGVQMSGVQ
LCQEGFGVLGIPLCQGMLACHTPLHCGCWGSCCVGSGLACWGLTVLGHVEIAGGVYGKGD
DTAGSAPAPSQVGGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCDEQHVFQNGSML
KPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPRKSIIFEPYPSV
VDPNDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQWI
ISSNRSHIVKLPLSRQLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
HSILRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYN
RMNTIPQTRSIQSRFLQSRNLNCIALCEAVITSKDLQKHGNIWVCPVSDHVCTRFFFVYE
DGQVGDANINTQDPKIQKEIMRVIGTQVYTN
Download sequence
Identical sequences U3K4U6
ENSFALP00000010050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]