SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010111 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010111
Domain Number 1 Region: 601-766
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00056
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.32e-32
Family Variant SAM domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010111   Gene: ENSFALG00000009694   Transcript: ENSFALT00000010151
Sequence length 814
Comment pep:novel scaffold:FicAlb_1.4:JH603303.1:1757192:1782665:1 gene:ENSFALG00000009694 transcript:ENSFALT00000010151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPEIEAREACDWLRAAGFPQYAQLFEDMQFPIDVKTVRRDHEFLDGDAIESLFRRLNT
LNKYASMKVEISRDRKRSDDSEDDEPCAISDRWAYERCTQRWSRIDSLPAFPAEEAAGAS
TPGSPILKIINNQDSVFLDHGEKHDVSSIHSTSSADSDIVNSQKPFEDVETSTSSSRCSS
VKVPSLDSAFSCSPPPSEFLNITSEEKLLDKSPSKKRKSLLKKMEKLHLRSCNLRSGQTK
AKPIISEPVLLEGLNEEKMKMLNCVNISDLSGIRTKNNSSFSPQSCNSSNQSVSSSTGST
PSPVIKPGSPCEGRGMYAEHMDSSKLGNDLSQHNLKNDTTLQKNQMFQIPQGHKPGTFPT
VLTDSSLSPADSSSVNWRTGSFHGCRRSQSSSGSKDARAPRSPQSGRDNRLSVYDNLPSS
DLESLQAAPAGDDDVFSELNSVIADVNGLKKLVDQWTEKFSDDGDSDFASDLTSLYPPSP
KESSLGAEGSEDKAAGEAEGESSCGLGKGIGSADLAFITDSKKTNRHGKQEWCVEERVNL
ESLSLQTDGQSAAQLARTQKLALLKLTALMDRYSPSSKQGWNWTIPKFIKKPKASDYKDK
NVFGVPLLLNVQRTSHPLPNGILQALEYLRSHFLDQVGLFRKSGVKSRILSLREMNETNP
NNVCYEGQSAFDVADMVKQYFRDLPEPIFTSRLCESFLHIYQYVPKDQQFQAVQAAILLL
PKENREALKILLFFLRDVVAFVEENQMTPTNIAVCLAPSLFHLNTLRRDSSSSSTRSSQR
KCSLGKPDQRELNENLAATQGLAHMIMECNRLFQ
Download sequence
Identical sequences U3K507
ENSFALP00000010111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]