SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010655 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010655
Domain Number 1 Region: 132-214
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.4e-16
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000010655
Domain Number - Region: 69-137
Classification Level Classification E-value
Superfamily EF-hand 0.00527
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010655   Gene: ENSFALG00000010216   Transcript: ENSFALT00000010697
Sequence length 607
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603458.1:187043:242237:1 gene:ENSFALG00000010216 transcript:ENSFALT00000010697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHQGTPGEEQGTLLFCTAGRCSQRADRGDKDKDQNKEHARSHGTAGWSLEVPGGSGEFC
RIDQALCHDEDEQLSFEAVRNIHKQMDDDANGNVDVEESDEFLREDLNYHDPAVKHSTFH
GEDKLISVEDLWKAWKTSEVYNWTVDEVVQWLISYVELPQYEETFRKLQLSGHAMPRLAV
NNATMMGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWF
AYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERTHKQIQTHNPSSSFLSHLRDTSHLA
LSYRSFVKVLEAVPENVSPRCLTVSPRCPQVRMALKNAEKELESHSSWAAPEALQKWLQL
THEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAN
TSLTILQLPLHFKLHNFNLIFKIPRMGMRSVCGGSTPSWAVPQPIDPGWMGPARHNPSHL
IITDDVDDLDEELVSPLSMQFPSAQSWAEPAPLPEPGHPGPQSKAAFPCGFSSFVHTLRM
ALLGWHHSGHGPACGEPGAGAAASCSSCSCSSTAPACHLHPIYYHHTASYFLQMDSTPDL
PPPDVTS
Download sequence
Identical sequences U3K6K1
ENSFALP00000010655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]