SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010755 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010755
Domain Number 1 Region: 77-157
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000314
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010755   Gene: ENSFALG00000010313   Transcript: ENSFALT00000010798
Sequence length 177
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603232.1:9822:19927:-1 gene:ENSFALG00000010313 transcript:ENSFALT00000010798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAAAASAHFSFCRSLLEHTVSAENLSYRLQRNPGSSLTWHDGRSQRPDGGHAVKLLRQ
PGTEGSQVRGCDHYGIYHTSPTLGSLVKPVVLWTQQDVCKWLKKHCPHNYLIYVEAFSHH
AITGRVLLRLNGEKLQRMGIALEAQRQEVLQQVLQLQVREEVRNLQLLSQASFGNVS
Download sequence
Identical sequences U3K6V1
ENSFALP00000010755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]