SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000011618 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000011618
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.48e-66
Family BAR domain 0.000000155
Further Details:      
 
Domain Number 2 Region: 256-315
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-23
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000011618   Gene: ENSFALG00000011132   Transcript: ENSFALT00000011665
Sequence length 318
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603201.1:1953946:1968549:-1 gene:ENSFALG00000011132 transcript:ENSFALT00000011665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKIDVTNKAVTELLSKSTEYLQPNPAYRAKLGMLNTMSKIRGQVKTTGYPQTEGLLGD
CMIRYGRELGDESMFGLALLDAGESMKQMAEVKDSLDINVKQNFIDPLQLLQDKDLKEIG
HHLKKLEGRRLDYDYKKKRFGKIPDEEVKQAVEKFEESKELAERSMFNFLENDVEQVSQL
AVFVEAALDYHKQSTEILEDLQSKLQNRINVASSRPKREFKPKPVITTTLEIGDNQQHNG
IAYSSSIKSSGSSVHMDQPCCQALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLNG
ESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences U3K9B4
XP_016156519.1.66865 ENSFALP00000011618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]