SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000011778 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000011778
Domain Number 1 Region: 639-749,784-828
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.19e-29
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000011778   Gene: ENSFALG00000011274   Transcript: ENSFALT00000011826
Sequence length 855
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603295.1:1386196:1504870:1 gene:ENSFALG00000011274 transcript:ENSFALT00000011826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSRQERIQKDIDVVIQKCKAEKDCLFADFRYSDSTFTFTYIGGSKSVSYSVHVSEDYPV
DNTYVSSSDNDEDVLVTTEPIPVIFHQIATELRKTSDVNYCLSIKSKLQRENGEESRHSS
TVEEDSEGDNDSEEFYYGGQVSYDGELHKHPQLEADLTAVREIYGPNAVSLREYGAIDDV
DIDLHIDVSFLDEEIAVAWDVIRTEPIIVRLHCSLTQYLNGPVPTVDVFQISTKERFGLG
HQLKKIMQTFVTQQWKNSKEKSNCTHNKKVSDKKVKSPLHIFSTLRRSPSYPPPGCGKNK
SKLKSEQDGISKTHKLLRRTCSSTVKAEDVCATKSHRTFGRSLSSDPRAEQTMALRSHKL
LSRACSAAVKQEECITLKPHKVLNRSCSGDPRCEHNSTLKPHKLLSRSYSSNLRMEELDG
LKNHKLLSKTYSNAPKSSKMEPFKESTMAESRRLSLTSGLIGILTPSSSSPSQAAQNYGA
KCIPVRDRGFLVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQT
LGVMNEAADEIATGAQVVDLLVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKK
NYDRVMKALDSITSIREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQ
LKFMHTPHQFLLLSSPPAKESNFRAAKNLYGSTFAFHGSHIENWHSILRNGLVVASNTRL
QLHGAMFGSGIYLSPLSSISFGYSGMNKKQQKVSAKDEPASGSKGSNTSQSQKKGQQSQF
LQSRNLKCIALCEVITSPDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDTSINTQEPNI
HKEILRVIGNQTATG
Download sequence
Identical sequences U3K9S4
ENSFALP00000011778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]