SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000012125 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000012125
Domain Number 1 Region: 231-339
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.14e-46
Family MBT repeat 0.00000106
Further Details:      
 
Domain Number 2 Region: 341-459
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.46e-44
Family MBT repeat 0.0000421
Further Details:      
 
Domain Number 3 Region: 448-575
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.14e-37
Family MBT repeat 0.0000129
Further Details:      
 
Domain Number 4 Region: 735-802
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000012
Family SAM (sterile alpha motif) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000012125   Gene: ENSFALG00000011622   Transcript: ENSFALT00000012175
Sequence length 812
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603172.1:9129711:9204446:1 gene:ENSFALG00000011622 transcript:ENSFALT00000012175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESASSGNGQEFDVFSAMDWKDGIGTLPGSDLKFRVNEFGALEVITDETEMESVKKATA
TTTWMVPTAQEAFSEKTGIPTRLKETAKVDGLVFCENCYRYGTIEEFVPEGKFCSQKCAQ
QVKNKEPKEENPSMECNGEDDSKGIRKRKAKVPLKEESRDNGEKKENPDEIEDKPEGRIL
RVSQRARRKRKGEITVLKQTVPSKGRQAWCWASYLEEERAIAVPTKLFKEYQSFPYNKNG
FKVGMKLEGVDPEHQSIYCVLTVAEVCGYRIRLHFDGYPDCYDFWVNADSSDIHPVGWCE
KTGHKLHPPKGYKEEEFSWPSYLKACKAQAAPKSLFENQNATVIPSGFRVGMKLEAVDKK
NPTFICVATVTDMVDNRFLVHFDNWDESYDYWCEAASPHIHPVGWCKEHKRTLITPPDYP
HAKHFSWEKYLEETSSLPAPARAFKVKPSHGFQKNMKLEVVDKRNPVFIRVATIVDTDDY
RIKVHFDGWDSIYDYWTDVDSPDIHPAGWCAKTGHPLQPPLSPLELVEALEHGGCPTAGC
KGVGHIKRARHIGHHSAVSCPYSEMNLNKESLLPDRLSGEMPAASPIPRNRKVETNERST
SPVINDRKCPSPGHIGMKSSPHNRPSGKTVPETTKLEDAENRSPCKKPLLCNVKEKKAPG
GMLQTKDALKHRECEEETENKLLISNEIKDIEEPNTQRLLSQPVIVSSKLQIPGLPLRWE
QQSKLLPSVAGIPASKVSKWSTDEVSEFIRSLPGCEEHGKVFKDEQIDGEAFLLMTQSDI
VKIMSIKLGPALKIFNSILMFKAAEKNSHNEL
Download sequence
Identical sequences U3KAS1
XP_005043609.2.66865 XP_005043610.2.66865 XP_005043611.1.66865 ENSFALP00000012125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]