SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000013679 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000013679
Domain Number 1 Region: 544-615
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.93e-17
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Domain Number 2 Region: 464-564
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000394
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 1084-1155
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000607
Family SAM (sterile alpha motif) domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000013679   Gene: ENSFALG00000013106   Transcript: ENSFALT00000013735
Sequence length 1160
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603172.1:21868166:21973443:1 gene:ENSFALG00000013106 transcript:ENSFALT00000013735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELRKRRVSQDLDLEKPDASPTSLQLRSQIEESLGLSSTASTPDTERKLSIHKSSSEEG
SVDWKKKNKFFWQNFRKNQKGLMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITI
EEALARLKEYEAQHRQSSTVDSTEWPDGSYSTLDGSSNCNSREQSDDETEESVKFKRLHK
LVNSTRRVRKKLIRVEEMKKPSTEGVEEHSLDNSPILDDRSALYSGVHKKQFYFDGSCEK
QPEDDSDSLTTSPSSSSLDTWGANRKLVKTFSKTDSRGLIKPPKKLGTFFSYPEEEKSQK
VCRSLTDGEMKKSLGSLSHGRTCSFGGFDLTNRSLHIGNSSDQMGKEGDFVYKEVIKSPS
ASRISLGKKVKSVKETMKKRMSKKYSSSLSEQESSPGIVPGSPQSPPPDTDSLDKPKLKA
GGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRARVHTD
FTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLNEEEEKPKRPT
RRRRKSRPPQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHR
AVLLTAVELLQEYDSNSDQSGSQEKLLIEGQGLTGCSPRDSGCYESSENLENGKTRRTCL
PPSKSASEHSFRDFSRNQLSNYPTLPLTKSIETLQPGEKESRLGCAHRALKSSVKPPALT
GLKKNRRSLPVAVCRSYETLDGPQGVDTWPRSQSLDDLQGEPNTNLQDTNKKVGSFPQDS
LDIAKKATGSALPPQSHGGSCKVDDAVAKQGKGAANSQKGRAKELNCSLMETAGGKPAPF
PLKNCEAQPALVMHHATRTPLEIQSKGFHDLARADYAPVLKGGLEAEQKSTNETRMQPKN
PSQPPPVPAKKCRERLSNGLYHPPTSGNNSSLEAPCLPVKKTSSSTPIDCHGVPVHRTSS
EQEPSSPPSPLPPWLSELPETASVQQHVVKLGPASARKVSCSRGMDLEMVIENKLQSEYI
DLTEEPYSDKHGRCGIPEALVQRYSEDLEQPEKDVATNMDQIRVKQLRKQHRMAIPSGGL
TEICRKPVSPGLITSVSDWLISIGLPMYSSLLTEAGFNTLSKVPSLSQTCLQKAGITEER
HISKLLAAARLFKPLDPEAI
Download sequence
Identical sequences U3KF75
ENSFALP00000013679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]