SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000013714 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000013714
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.04e-18
Family SAM (sterile alpha motif) domain 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000013714
Domain Number - Region: 283-363
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.0186
Family Type 2 phosphatidic acid phosphatase, PAP2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000013714   Gene: ENSFALG00000013133   Transcript: ENSFALT00000013771
Sequence length 413
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603243.1:1129720:1164094:1 gene:ENSFALG00000013133 transcript:ENSFALT00000013771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGSMKEVVLWSPEEVAGWLTDNAVPEYCEPLRSFTGRDLINLTEEDFKRSPLCRVSSDS
GRRLLNMIEGLKMAHHMEAHKNGHANGHVRGAAGQNGFGAALKLNGVPNGFKKEMIKIPM
PEPERSQYPMEWGKTLLAFIYALFCFVFTTVTISVVHERVPPKEVQPPLPDAFFDRFDRV
QWAFSICEINGMILVGLWFVQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGM
HFKCSPKLFGDWESHLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVILTLTYLFIKEYS
PRRLWWYHWLCWALSMVGMFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQVLKEAS
QTNLLARVWWYKPFQYFEKNVQGIVPRSYHWPPRCPALARGRPVKYSRLVSDT
Download sequence
Identical sequences U3KFB0
ENSFALP00000013714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]