SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000014132 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000014132
Domain Number 1 Region: 859-1057
Classification Level Classification E-value
Superfamily Macro domain-like 5.55e-52
Family Macro domain 0.0000961
Further Details:      
 
Domain Number 2 Region: 1691-1873
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.44e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.019
Further Details:      
 
Domain Number 3 Region: 1279-1451
Classification Level Classification E-value
Superfamily Macro domain-like 1.68e-38
Family Macro domain 0.0007
Further Details:      
 
Domain Number 4 Region: 1080-1258
Classification Level Classification E-value
Superfamily Macro domain-like 1.28e-34
Family Macro domain 0.00035
Further Details:      
 
Domain Number 5 Region: 1562-1672
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000772
Family WWE domain 0.0066
Further Details:      
 
Domain Number 6 Region: 53-61
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000014132
Domain Number - Region: 18-70
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000136
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Domain Number - Region: 302-374
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000406
Family Canonical RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000014132   Gene: ENSFALG00000013541   Transcript: ENSFALT00000014190
Sequence length 1873
Comment pep:novel scaffold:FicAlb_1.4:JH603187.1:4617226:4638124:-1 gene:ENSFALG00000013541 transcript:ENSFALT00000014190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPARGERETESGGPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
PPPQQSRAAMEGQRPCAFPLLVRGDWGPAEPPPALRKKLLCYFQSQKRSGGGECELRTGT
GTGTGHIIVCFARPEVKQRVLERQSHQLHLEGEENLRLIVTEPETALATKDERLEEKSVP
TKALDAMSSLQTKDDTKTLKKAESFVPNSELQEEVDSPEASPSVVFENIERCGPKLLQML
LENISGLDVDADFTVELIPEINVAVATFIKSIDTEEFVKKCSEHKRVREFKMTVRLLEWT
QTIKAENLPDSISTDYLTVYFENARNGGGPVSDVQLFPEENSAIITFCDHKDLTMVLEKQ
HLLDETLISVHPYYHSLGTALYGEERPAVKMPDPIGVPLDPYVWQFLQRHANLTQDINQE
MAVCHSELKWPQADCANPEVMLCPSPSLCKQKKPMVKLLKTWHQDASTEFSRIMARYIAI
KCEVNSSGWEDVKKRLLQDDALIITDVSEEMVVIAGNRAAVDSAEKEVRECMKQSEREKQ
SIEISVPVIPGKYAVLCNAGLEENIQKEYPCLKIFYDDKKKTVQLCGLPSEVYKIKADLL
EKVMSMPCTSVTIDPHVFQYLRCVDNKKTSDMLFIREKINTFYELQDDTVLLYGDAPKDL
QEAEKRIKTGLEYKCINVGDGEVIKKDLWKSLLLSLLETYNSSQEMVITWQSAGKENKMI
IAGFSKAVRKVYQRLNDFVDRNTVIEKVISATSVVNVQFVENEKSGVCEELKKKGVTVHF
DTKTPCISLRGPRAEVPEAFIMFEKIVSSLYSKDVPIDKPGAKEFFMERKDFCISEAKQK
FGCFIEIKEEKEQQQKVGKVSDKVKRKVYYEKTLPGGIVVGVYKSNLCDYPVDVVVNACN
GDLRHIGGLAEALSGAAGPALQQECDELVRKHGNLQPGCAVITGAGNLPCKNVIHAVGPR
WNEKESQTCTCLLKQTVRKCLQLADIYNHCSIALPAISGGIFGFPPQMCADSIVTSIKET
LEEFMEGSSLKEVHLVSNSEEIVQVLSDTVKKVFSAKSSSARWLMAKKGQKEKSKGDLKM
VTTKEGLCIRVEKKNVQEAVTDVVVNSVGTDLKFGVGPLCNALLGRAGPGLQDEFDTTVK
SQVAGPGTVLCTSACAMACKFMFHAILPVWDGGQTEKVLEDIINLCLKKTEELGLKSITF
PAIGTGGFGFPKTIVSKLMFDVAFRFSSSQAWKNLQEVHFLLSPKDIDSIQAFTTELKLR
ADESCNAAAAQPGFIRPVSSELLGVHEMKIGSITLQVISGDITKQDTEVIVNISNQTFDA
KTGVFKAIMDAAGSQVADECAQHAGQNQSGFVTTQGGNLLCSKIIHLISDNQVKSQVSKV
LHECERRMYKSVAFPAIGTGQAGLSSAKVADEMLDAIVEFARQKSVQHLQTIKIVIFQTN
MLRDFYESMKKREDSDSSTTESWFSMLKSFFWGRKQSSEKKKVLNLEKKVNLVTFQICGE
SQKKVDETESWIKDLILKEQFENTISHEVIESFDETQIAILEDLQRRMQVTVQFKNNLSP
PQIKISGISRDVCSVSQKVQEMIQQIKSCEEEQSKAELLFNLVEWRYPGSNDSFVSFDKL
TNMQLEHAKISKKLHLNVKIENKNYRVDLNTLKATDDQGNTINLQRVRKDEDMQSIELPK
EWTDMQNEQVKVVELKPSHPEYKRVEKMFKTTCANFTIEKIERIQSRILWQTYQLKKKSI
CEKNKNQNNEKLLFHGTAASSLRLINSYGFNRGFAGKNAAAIGNGTYFAVEARYSARDTY
SVPDVNGKKHMYLAQVLTGKYCAGRRGINAPPPRSQADPTDLYDSVVDNESNPTMFVIFN
DIQAYPQYLITFK
Download sequence
Identical sequences U3KGH8
ENSFALP00000014132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]