SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000014136 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000014136
Domain Number 1 Region: 717-910
Classification Level Classification E-value
Superfamily Macro domain-like 1.03e-54
Family Macro domain 0.0000743
Further Details:      
 
Domain Number 2 Region: 1547-1730
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.47e-41
Family Tpt1/KptA 0.086
Further Details:      
 
Domain Number 3 Region: 1145-1311
Classification Level Classification E-value
Superfamily Macro domain-like 9.76e-41
Family Macro domain 0.00048
Further Details:      
 
Domain Number 4 Region: 932-1104
Classification Level Classification E-value
Superfamily Macro domain-like 2.69e-36
Family Macro domain 0.00045
Further Details:      
 
Domain Number 5 Region: 1425-1529
Classification Level Classification E-value
Superfamily WWE domain 5.89e-16
Family WWE domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000014136
Domain Number - Region: 154-229
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000157
Family Canonical RBD 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000014136   Gene: ENSFALG00000013545   Transcript: ENSFALT00000014194
Sequence length 1731
Comment pep:novel scaffold:FicAlb_1.4:JH603187.1:4640887:4655620:-1 gene:ENSFALG00000013545 transcript:ENSFALT00000014194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFENKRRSGGGDIESYVKKDEQVIITFQDEQDAQEVLQRKHHLKNIDLVVRPWQVQTSQ
ELCQVENTEGSLLPTAVVLENVKETIKDGMLILLVENVSGLSEDDGDFSVEMIPELCAAV
VTFTGNTDAKEFAKKLNQNPRARKQNITARCLEQTKSVRVENIPPNTPSHYITVYFENEK
YGGAQTVDVQLLPDEDAALITFGNPKDVTNILAKKHSLNKTPIFVYPYYTSLETALYGKE
GPQIKKPDPITLPLDPYIWNYLQGNSSLVEAIGHEMAKCNCVPTWPDPLCADPKVTLHPS
AIFSQRKRSVSQLAKTWKEKVSAAFSHSISKYEAIQCQVSTEVWEAIGNSFPHDKVLMIP
RISEDLHVLVGEKEVVKKVEQELKLLIQKATREIEREKQRTELKVEMVNPGEYVILQIIG
LEEKFHAEFPDLQITYDYMQKCIKLSGVSEEVYKVKGEILEHVHKMAKKTINVHPYILQF
LEHIDNETLSQSLFVSKQISAFYELGAGEVILKASDPEDLLKAEKEMKKELAHKSIALDD
ESVLQKEEWQMLARTTCSNGAVAVTQAETQVVIAGLSEAVAKAFEELSNFIDENTQVQRV
IEGKPMALIKFFKKEKVNAWAPLQEKGVKVDFGTQKICDVISLSGPKTKVLEGVILVEQI
LSGLHFKRVVIDLPGAKAYIKEQAHFLDSHIKQVFKCLVLLEEEPEKQLEEQKVHGNRGK
ICMQVTVGKTVVALYEADLCTHPVDVVVNASNEDLRHIGGLADALSGAAGPALQQECDEL
VRKHGNLQPGCAVITGAGNLPCKNVIHAVGPRWNEKESQKCTWLLKKTVKKCLQLAEAHN
HCSIALPAISGGIFGFPLDVCTYSIVSSVKETLEEFKGSSRLKEVHLVGFSKDNIQAFRK
AFRKVFPGSLPSCRPSHHVPQPSRKKHCKNFPVITTQEGLDIVLRTGNIEGATTSVVVVS
VGKDLQLDKGPLGKALLSKAGPMLQTGLQKEGGGRTVEEGSVLKTKGYNLSCSVVLHAVV
PGWSQENRPAKVLGDIITKCLEIAEELSLKSITFPAIGTGNLGFPRSVVAKLLFDKVFEF
SSDNRVNSLEEVHFLLHTKDTANIQEFSDELENRSVAVKGQKPSSNDTSQSLAFSAISST
SAHNVLEVTIGSLVFRVAEGDITKEEGDAIVNITNLTFNLKRGVSSAILNGAGKAVEDEC
GVLAQQTSNKYIITQAGNLPCKNIIHVVAQEDIRSLVSQVLQECELQQYTSIAFPAIGTG
EARRNPAEVADNMIDAVTDFAKRNPATSVKTVKVVIFQPHLVGVFQASMQKRENSTATRI
KSFVSKAFQMGKSLWSSEKHPPKEKIERVLEKKIELAVVQICGEDKKEVEGAEKWLKNAI
LKEQSKTEIVHESISHFGEEEKEELDDLQKKFGIALDLKSTSIEISGITKDVCQASVDVH
KMILRVKTAKETEAKHLQNSIEWQYFEKDSYVPFNSLTNMDLENAYQGGQKTVEVTIDER
IYTVDMARKTAVDADGGQIPITRVDKSEDQKSIVLPATWDPVENERVKIVELKPDSREYK
DVQEKFLQTCQSFKIEKIERVQNRYLWKNYQIKKCEMDKRNGNRNNERFLFHGTSQESLP
LINDRGFNRSYAGMHAANFGNGTYFAVNASYSAQDLYSKPDVNGKKYMYLAQVLVGEYSQ
GKKGSITPAQKTAGNSVDLFDSSTDNVNQPSMFIIFNDIQAYPAYLITFTR
Download sequence
Identical sequences U3KGI2
ENSFALP00000014136 XP_005049681.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]