SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000014694 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000014694
Domain Number 1 Region: 25-250
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.24e-64
Family Ecto-ART 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000014694   Gene: ENSFALG00000014078   Transcript: ENSFALT00000014758
Sequence length 265
Comment pep:novel scaffold:FicAlb_1.4:JH603810.1:20601:21395:-1 gene:ENSFALG00000014078 transcript:ENSFALT00000014758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMAHLALTLAVLAMTVATTAYKKKTLDMAPYSFDDQYRGCGSAMKAKLPALKRSEFQKNR
LFAKGWQRAVAEWQSRGSRVSPLSSSDQAIAIVAYTMNDLFKEFNNKVRVAGRYRWVYRK
WFHFKALHFLLTDALATLRAAQGQKCHRVYRGVDNYLFAAKRGNTVRFGQFASASLCERV
ARRFGKTTMFKVQTCHGAYIKAFSKFSKEEEVLIPPFEKFNVTNVIKKGKKVEIYLESIG
TYSKYNCEWLKGGDSLGPWGHPLGP
Download sequence
Identical sequences U3KI40
ENSFALP00000014694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]