SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000001145 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000001145
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.03e-81
Family BAR domain 0.0000000145
Further Details:      
 
Domain Number 2 Region: 287-365
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000001145   Gene: ENSFALG00000001091   Transcript: ENSFALT00000001151
Sequence length 369
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603387.1:429737:457410:-1 gene:ENSFALG00000001091 transcript:ENSFALT00000001151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKATQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLTRTIEYLQP
NPASRAKLTMLNTMSKIRGQVKNPGYPQSEGLLGECMIRYGKELGEDSNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQAMEKFQESKDVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKL
KRRMREASSRPRREYKPKPRETYDFRESDQSNGGFPCNPTPKASEAASASFRSDKPSRAS
VRSIPPLDQPCCKALYDFEPENDGELGFKEGDIITLTNQIDENWYEGMIHGQSGFFPLNY
VEVLVPLPQ
Download sequence
Identical sequences U3JEE1
ENSFALP00000001145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]