SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000002147 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000002147
Domain Number 1 Region: 741-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 825-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000881
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 3 Region: 412-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000461
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 578-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000907
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 500-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000858
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 668-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000534
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 7 Region: 786-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000615
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 870-921
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000645
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000002147
Domain Number - Region: 48-162
Classification Level Classification E-value
Superfamily SET domain 0.00209
Family Histone lysine methyltransferases 0.049
Further Details:      
 
Domain Number - Region: 471-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00637
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 227-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0152
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000002147   Gene: ENSFALG00000002064   Transcript: ENSFALT00000002159
Sequence length 1183
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603313.1:1061210:1096367:1 gene:ENSFALG00000002064 transcript:ENSFALT00000002159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDGSEEIIFIWCEDCGQYHDSECPELGPVVTVKDSFVLSRARSSLPSNLEIRQLEDGT
EGVFALTQLVKRTQFGPFESKRVLKLEEESVFPLKVFQKEGPLVYFDTTNEDDCNWMMMV
RPATEYEHQNLTAFQHDNDIYFTTCQDIPPGTELRVWYAAFYAKKMEKPVLKQVTSVAND
TSLAAMESDKEGNNKVSSKPSSAVLPHKKPKKSSILAADPAVNTPEGSGTAEAKPNQWTC
KVCSSAFQEPQLLTEHLLSHLEQTKGAPPSSQKDAETGEKAAEAVPADQPVASDAASAST
DSRRKARRGRKAKTAKVETPLVIDEEKDSAVERVADTVTEVPPEEVALPPAPEERIMDLV
LGKMPSTTNSISSVTNRFAHHQNTMSLKRSLILSSRHGIRRKLIKQLGEHKRVYQCSICS
KIFQNSSNLSRHIRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRNEVDSEYRYKCTTC
EKAFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGDKKFACEICNKMFYR
KDVMLDHQRRHLEGVRRVKREDFEHSTENMVRYKKEPSGCPVCGKVFSCRSNMNKHLLTH
GDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKIGISSEENDDNSDES
ADSEPHKYSCKRCQLTFGRGKEYLKHIMDVHKEKGYGCSICNRRFALKATYHAHMVIHRE
NLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCGKSFARKDMLKEHMR
VHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECKECHRKFAQKVNMLKHYKRHTG
IKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTDYMLQKHIQLTHDKVEA
QSCQLCGTKVSTRASMSRHMRRKHPEILSVRIDDLEPLPETTTIDASSIGIVQPELALEQ
GELPEGKQPIKAPKRGQKQKQKSGEEEEAQVPEDPAFSEYTEKEGEFTGNVGDETNSAVQ
SIQQVVVTLSDPNVTAPSSSVGLTNITVTPITTAAGTQFTNLQPVAVGHLSPPERQLQLD
SSILTVTFDTVSGSAMLHNRQSDIQLPPQPEAPNPQSVAHFINLTTLVNSIAPLGSQMPD
QHPLSWRSVPQTDVLQPPAPAAPQQPGQQPVQTEQQQQQMYSY
Download sequence
Identical sequences U3JH93
ENSFALP00000002147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]