SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000002363 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000002363
Domain Number 1 Region: 216-307
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-17
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 88-148
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000228
Family Ankyrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000002363   Gene: ENSFALG00000002269   Transcript: ENSFALT00000002375
Sequence length 711
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603246.1:787930:835192:1 gene:ENSFALG00000002269 transcript:ENSFALT00000002375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRKTLLNGCSFPCRKHWLRMTQQMHSLGLLQSKKHSVPSSPSAAKRLYRNLSEKLKGSHT
SFDEAYFRARSDRLSLRKASMNFQCNEAMFEAVEQQDLDAVQILLYQYTLEELDLNTPNS
EGLTPLDIAILTNNVPIARTLLHVGAKESPHFVSVESRSVHLSTLVQEAQQRVVELSAQA
GSEGLGTESAEREKQLKGWEWRARLYQRMKDGYEHARAPEAPTNVCLMVTSSTSLTVTFQ
EPLSVNSAVVTKYKVEWSSSEDFSPLAGEIIMDKLHSLRCSITGLRTGQRYFVRVSAYNI
RGWGPPCKSTPECASPSNWKDCSGREPRHRGHTEALERLLQQVRAAHQHYNCRESSKLQN
AGRKQSVSRSLKHLFHSSNKFVKTLKRGLYLSVILFYKDNLLVTNEDQIPIVEIDDSHSS
SVMQDFLWFTKLSCMWDDIRWLRQNMAVSVSSSTALQARQKMLSAAAQLQNLLGTHNLGR
VFYEPIKDRHGNMLIVTVREVESLYSFFNGKWMQVSKLQSQRKSLSTPEEPTALDILLIT
IQDILSYHKRSQQRLPPGLYLGYLKLCSSVDQIKVLVLQKLPNVLCHVKIRDNSNVSKDE
WEWIQTLSGSESVESMDHTADCPTQLFLYELQTAVKALLKQINLPLHQAKHFRLYTQEVL
ELGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT
Download sequence
Identical sequences U3JHV9
ENSFALP00000002363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]