SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000002751 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000002751
Domain Number 1 Region: 720-837
Classification Level Classification E-value
Superfamily SEA domain 6.93e-20
Family SEA domain 0.0073
Further Details:      
 
Domain Number 2 Region: 228-312
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000432
Family SEA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000002751   Gene: ENSFALG00000002633   Transcript: ENSFALT00000002763
Sequence length 919
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603208.1:787962:843405:-1 gene:ENSFALG00000002633 transcript:ENSFALT00000002763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLKTGLIFLIICLALQVQGSREIPNKINRAEAKHLAVTSGSDKTERTTKRSRISTIRRI
FDMAKHRTKRSSFFSTGVKVCPQESVKQILASHQAYYRLRVCQEAVWEAFRIFLDRIPDT
SEYQNWVTACQRETFCIFDIGKNFSNSQEHLEIIQRRVKHRTFQERKDEISAEKTGGKKV
EDIPSISTGSPGTPLSPYAPNGTLLNEIFNDTKTPVKELGTNAVPELPVEQMVEFSVTLT
DQEYIAELSDPNSPEYQQLAAKFQLQMKKIFEKLPGFKEIRVLGFKQKKEKDGSSSTVAR
YVVNFERDGSEATGSADDISTIGSNKVESEKIPISPVEEREISATRLTVTDLQQLVASAL
HEDQSLPVDLGTLQFTDETIIPPSDLDNDIQGVVTIPLAGPDLVEHLQEELPLGYPSPAT
VDQRGDVFVGESTTESPALSEEISIPEEFNNFITSEPDFPTKPSREPFQDRYPYTQVIAT
DLPSFTVPFSALGSTSSPPKPEDSYLPPPADDSAGKDLLTDADEPPVELATAGSFTTAEL
LPAAEVESAAGEQQLPEAAEPPAEEPGQESLSGQAVKITEEPESSGDDIFVTASTYDRLP
FFTGPSGVPTAQPGAVPTDEPPSVAPLPAAASPSYSPSEIIEQSLELPGSSAPAPEGAPR
DGAGLGVQDIAAELDRAGAVSTAALDEGEPGSADIPELPSEPAGTSPAPALSYVTTSSMT
TAAKGKELVVFFSLRVTNMHFSDDLFNRSSTEYKALEQQFLQLLLPYLQSNLTGFKHLEI
LNFRNGSVIVNSKMKFAKTVPYNITEAVHCVLEDICDAAAQHLNLEIDSYSLDIEPADQA
DPCKFMACDKFSECVMNEWTKEADCLCKPGYASQDGLPCRSLCELEPHLCLNGGKCELVP
GRGAVCRSPDEFTKPRLTS
Download sequence
Identical sequences U3JIZ7
ENSFALP00000002751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]