SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003048 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003048
Domain Number 1 Region: 686-901
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-106
Family Thrombospondin C-terminal domain 0.0000000771
Further Details:      
 
Domain Number 2 Region: 559-684
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.76e-34
Family TSP type-3 repeat 0.00000459
Further Details:      
 
Domain Number 3 Region: 477-561
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.59e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 187-232
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000222
Family Assembly domain of cartilage oligomeric matrix protein 0.0017
Further Details:      
 
Domain Number 5 Region: 409-501
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000484
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 6 Region: 16-114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000995
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 7 Region: 277-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 325-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000543
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000003048
Domain Number - Region: 385-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00187
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 237-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0893
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003048   Gene: ENSFALG00000002926   Transcript: ENSFALT00000003061
Sequence length 918
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603406.1:308952:315287:1 gene:ENSFALG00000002926 transcript:ENSFALT00000003061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVAHKIRMELLTVNDVYLLSTFRLPPKQGGTLFGLYSKKDNTRWLEVSVVGKINKVLV
RYLREDNKVHSVNLQHAHVADGQSHSVIVRLSGLRRDTLSVELYVDCKQMDSSVGLPELS
EIPLAEVESIEVRTGLKAYQRMQGFVESMKLILGGSMSRVGALSECPFQGDESIHSAVTS
VLASILGEQTKALVTQLTIFNRVLTELREDIRDQVKEMSLIRNTIMECQVCGFHEQRSRC
NPNPCFSGVDCMETYEYPGYRCGPCPPGLEGNGTHCTDIEECAHANPCFPGSKCINTAPG
FRCEPCPRGYRGNTVSGVGVDYARASKQVCTDIDECNDGNNGGCDPNSICTNTLGSYKCG
PCKSGFVGNQTSGCVPQRSCSTPTSNPCDINGFCLFERNGEISCACNVGWAGNGNVCGPD
TDLDGYPDEPLPCIDNNKHCKQDNCRLTPNSGQEDADNDGIGDQCDDDADGDGVKNVEDN
CRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQRDTDSNGEGDACDNDIDGDGIPNMLDNC
PKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDMDSDLVGDICDTNEDSDGDGHQDTKDN
CAEIPNSSQLDSDNDGLGDDCDNDDDNDGIPDYVAPGPDNCRLIPNPNQKDSDGNGVGDV
CEEDFDNDTVVDQLDVCPESAEVTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQT
MNSDPGLAVGYTAFNGVDFEGTFHVNTITDDDYAGFIFSYQDSASFYVVMWKQTEQTYWQ
ATPFRAVAEPGLQLKAVKSSTGPGEHLRNALWHTGHTPDHVRLLWKDPRNVGWRDKTSYR
WQLAHRPQVGYIRVRLYEGPQLVADSGVIIDTTMRGGRLGVFCFSQENIIWSNLQYRCND
TIPADFEPFRRFLLEGRE
Download sequence
Identical sequences U3JJU4
ENSFALP00000003048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]