SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003140 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003140
Domain Number 1 Region: 119-178
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000733
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 2 Region: 158-168,200-219,369-420
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000711
Family Cytochrome c3-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003140   Gene: ENSFALG00000003017   Transcript: ENSFALT00000003153
Sequence length 440
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603325.1:1057944:1063005:-1 gene:ENSFALG00000003017 transcript:ENSFALT00000003153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDERLARFRQAHLNPFNKTPEQLERPEEESPAPAQQPDPAPGDPEGALDLGLAEDHFS
RPVGLILASDVPQLRRAIEECKRVILALPEHSERQKDAVVRLIHLRLKLQELKDPAEDEP
NIRVVLEHRFYKEKSKSVKQMCDKCSTIIWGLIQTWYTCTGCYYRCHSKCLPLVSRPCVR
AQVSHQAEYQLSICPESGLDSQDYRCAECRAPISLRGVPSEARQCDYTGLYYCSSCHWND
LAVVPARAIHNWDFEPRKVSRCSMRYLALMVSRPVLKLREINPLLFNYVEELVEIRKLRQ
DILLMKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSLQDLIDIEAGRLGCSLTEIHTL
FAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRDCYYDNSTTCPRC
ARLSLRKQSLFQDSGTEAEP
Download sequence
Identical sequences U3JK36
XP_005052298.1.66865 ENSFALP00000003140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]