SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003175 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003175
Domain Number 1 Region: 11-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-79
Family BAR domain 0.00000000228
Further Details:      
 
Domain Number 2 Region: 285-349
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-22
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003175   Gene: ENSFALG00000003049   Transcript: ENSFALT00000003188
Sequence length 352
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603272.1:653866:745874:1 gene:ENSFALG00000003049 transcript:ENSFALT00000003188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMAKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLADAMLKFGRELGEDCNFGPALVDVGEA
MKELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKMEGRRLDFDYKKKRQGKLPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQATQILQRVTSKL
EDRIKEASSQPRREYQPKPRMSLDFVTGDNTQHNGGISHATTPKPSGAHMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences U3JK71
XP_005060947.1.66865 ENSFALP00000003175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]