SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003187 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003187
Domain Number 1 Region: 416-587
Classification Level Classification E-value
Superfamily SPOC domain-like 2.94e-50
Family SPOC domain 0.00014
Further Details:      
 
Domain Number 2 Region: 23-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-28
Family Canonical RBD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003187   Gene: ENSFALG00000003062   Transcript: ENSFALT00000003200
Sequence length 589
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603249.1:2117646:2119537:1 gene:ENSFALG00000003062 transcript:ENSFALT00000003200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGGGAGAAAEEEISPEDDQRANRTLFLGNLDITVSESDLRRAFDRFGVITEVDIKRPGR
GQTSTYGFLKFENLDMAHRAKLAMSGKVLLRNPIKIGYGKATPTTRLWVGGLGPWVPLAA
LAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAQAACTHMRGFPLGGPDRRLRVDFADTE
HRYQQPYLQPLPLPPPAHYELVAEAAAFGAHRGAPPDPLRGARDRTPPLLYRDRDRDLYP
EAEWVPPPPPVRDRGNRAAAYDPLESLERRRDGWSLERDRGERELGSSSRDQPRKRRLAE
DGGRHLDRSPDSERSSSSRKRHCLATTSPPDRSPELLGGRERYSSDPERSSRLLLLERPS
PIRESRRGSLERGQNDKRDRKNSAERERKHRAAAAQECKSPAKKDERAAEAGAAPKLCLA
WQGMLLLKNSNFPSNMHLLQGDLGVASSLLVEGATGGKVAQLKITQRLRLDQPKLDEVNR
RIKVAGPNGYAILLAVPGASDNRAAAAAAEAATTSTQRPLRNLVSYLKQKQAAGVISLPV
GGNKDKENSGVLHAFPPCDFSQQFLDSTAKALAKSEDDYLVMIIVRGAS
Download sequence
Identical sequences U3JK83
ENSFALP00000003187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]