SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003703 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003703
Domain Number 1 Region: 2982-3149
Classification Level Classification E-value
Superfamily SPOC domain-like 2.28e-63
Family SPOC domain 0.0000000317
Further Details:      
 
Domain Number 2 Region: 33-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.9e-31
Family Canonical RBD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003703   Gene: ENSFALG00000003551   Transcript: ENSFALT00000003717
Sequence length 3150
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603390.1:56666:85073:-1 gene:ENSFALG00000003551 transcript:ENSFALT00000003717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIEVTAWIGPETESENEFRPLDERIDEFHPKATRTLFIGNLEKTTTYHDLRNIFQRFGG
IVDIDIKKVNGVPQYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDG
LSTNVTDQYLTRHFCRYGPVVKVVFDRLKGMALVLYNEIEYAQAAVKETKGRKIGGNKIK
VDFANRESQSAFYHSMEKTGQDIRDFYEILAERSRDERRGSYEYAPDRTYYETVRTPGTY
PEDPRREYPARGREFYAEWDPYQGDYYDPRYYDDPREYRDYRGDPYEQDIREYSYRQRER
ERERERFESDRDRDHERRPIERSQSPTHSRRPQSPGASPSQSERLQSDSERRIYSRSSDR
SGSCSSLSPPRYDKLDKARVERYAKNEKVEKERVFEQERVDKEKRLVRKEKLEKIEKEKT
DKQKRKAKIHSPSSQSSETDQENEREPSPEKLKGNSKQSKERSDKEGTAKNRLELMPCVV
LTRVKEKEGKVIDQPALEKLRAKLDNDTLKSPLLEQKTQTSQAEQAKSEQSKLEPVRTKA
QKEKALASHIEVVDKEGKVKPKKHLKTEQTSEGANAVDLDKLEARKRRFADANPKSDRQK
LDVKRSSQDEEDARTVLKKQLDATASSREAPVLREGELERKPLRKEMLKRESKKLKLERL
IPVTSPKEVQDTLNVGGVGMHPTLDLQVRLMEAPDEPVEVQELPPKKPNPVKPQHKQVQL
LDEQGTEREDARKNYSGLPEEAPDHKLGQEKPASADTEEKISIDIDHTQSYRKQMEQSRR
LKQQLEMEIAKSEKFGSPKKDVDEYEKRSLVHEVGKPPQDVTDDSPPSKRKKTDQFDFEI
STKRERNYRSSRQVSEDSERTSCSPSIRHFPFHEDDDTLDSPRIMPLKETKESPKIEEKS
LSYSNMTVREDSLKFNPYDSSRREQMAEMAKIKLSVLSSEEDSSRWETQVKQEPGRVDIS
FPSSIVKRDSIRKRSVRDLEPGEVPSDSDDDGENKPHSPKASSLLESSRLSFLLRDREEK
FREREERLQSSSLERNKFYSFALDKTITPDTKALLERAKSLSSSREENWSFLDWDSRFAS
FRNNKDKEKVDSAPRPIPSWYMKKKKIRTDSEGGKLDDKKEDHKEEEQERQELFASRFLH
SSIFEQDSKRLQHLERKDDDLDFISGRLYGRQSSSDGTNSTADLVQEPVVLFHSRFVELT
RMQQKEKEKDQKPKEVEKQEDKENRPKTPEMVPDSKETEHKPSSVVGPSSVTILPQEPAP
IAPEKIASEKVLVEPASVKEEKPSEPAAAAEEQKPFSELAAPIKMEPPEQAEPLPVVEAS
KEIVATTVAPEEDAVATEHPSYLDTKPPTPGASFSDADINVDPEPEAAQLLPPPPKLVQK
SDEAAEPKEENPPPSANTDAAVSQKVEAAAEVLPPVSDNDVEVEPPVVVKDKKSYKSKRS
KTPVQSAATNVMEKPVTRKSERIDREKLKRSSSPRGETQKLSELKVEAEKVSRNAAKSPS
SAAEPENVELSLPIGRTRRRNVRSVYATTGDNEGPSPVKDSMEVTRSTRKRVEKEPQETV
TTVPTTPRRGRPPKTRRKPEEDISPIKTEPVQQEVEEAETKDSVEAPKPAEGWRSPRSQK
LTHTHLPAATSQQGKKGKNEPKADTTAESEDASERSGQESSVSDSSTKAKATEKEPAASE
QKRDRKELDVEKNQLEIPAVEIIEKKPVPEKATKSKRGRYKNTKTVVDKASVCLKNVEIR
LNVDEVKGALRPTEEEAEPVAVSPPKMKSPPKEDILPPHFSKNEAEDSFPEMEKEVTREP
KQSPEAAQLAKQIELEQAVENIAKLTETPPTIAAYKEPTADVAEVRQEEEADKPAHQASE
TELAAAIGSIINDISGETESFPAPPTYPAESEAEIPTEPLVLQSPREEMEPETDQAVNNI
LETEAAVEPVVQPVPGSVPLALETESKESEVSFSESSNSAQEAETLQEAEVARKEKGRQK
TTRQRRKKSTSRKGDTAEVNAFEPERVQSKSPPANEVKTKPEEASKEEKQIKPTAPMEPS
ASDVTKAVAADVVAAHEAVPESSTSPKLPAPAPLDLGAPPVPLDEGSQSGFKIRSPLENA
PITPPSAPSAALPAVPTAAAKLPLPVPTAIVPLHSGAAKVPEWMVRHEEPRARSTPPPAL
PPDTKASDIDTNSSTLRKILMEPKYVSATSITSTHVTTTHAEPVSAPCLEEAPLHPAVEA
IKPVSEEKPAVPVTNALEPPVAEAPVFSEKEKINTMIAPKATSVISRMPHSVDLEEAPRI
TLVKQAPQTQTCLVNAPSPKFKQRSSTNDNSRFHPGSMSIIEERPVETGSSPGLRVNTSE
GVVLLSYSGQKTEGPQRISAKISQIPPASAVDIEFQQSVSKSQIKQEPITPSQPAPKGSQ
TTAGYGTVSTHSSLVLGTQPYNTSPVISSVKQERAALDKPDSSHLAVQTPASQPGKVLTQ
TVNTPPVLVHNQMVVNKKLSDPAALKVETKTLQPSNLSPGVSPHHPSISGKMHSEANHVS
SGPNTPTDRAISHLGVSKQEPHSPRTSGHSPSPFPRACHPGSTSSPALSSNTPVMLAPGI
PVPQYISSMHPEQSVIMPPHSVTQTVSLGHLSQGEVRMNTPPLSGIPYGIRPEALHSPRA
ALQPQMEIKTQRSSTPQPAPIRDIVMPPLSSQHPPEEDLHFHHTTVCRGPAPVQSDVLVM
QPDYRMHPSSLRLDQYNVPRDVRMIMHPHMAAVGEHHSETRQSRTPEGAVKTPPVSKTPQ
PGKETPKTSEGKMAHSPHSEPRLLSVPSGSQLPGLPLTQPVVVPHGVQIMHPAGSSFHDY
RSVYGDMRNYHTAQLGHPQFPGASPIGLPSRSMTPSQGLPEGEHSHPSQPVRSKTPQIPQ
DPKGPAAAGPEQSHHAPVNRHTAQMDPHVHLQRAQGDTSQTSYPSPVAISMKQELPSPHQ
PQAVPKQSMFIPTTSGAPLGRLEPQSTLKQEPSPHPVSQRPVDMVQLLTKYPIVWQGLLA
LKNDTAAVQLHFVSGNNVLAHRSLPAPEGGPPLRIAQRMRLEASQLEGVARRMMVESDYC
LLLALPCGRDQEDVVSQTESLKAAFISYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEF
SESHLSRLAPDLLASISNISPHLMIVIASV
Download sequence
Identical sequences U3JLP9
ENSFALP00000003703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]