SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000004096 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000004096
Domain Number 1 Region: 43-171
Classification Level Classification E-value
Superfamily TPR-like 1.82e-18
Family Tetratricopeptide repeat (TPR) 0.005
Further Details:      
 
Domain Number 2 Region: 847-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000814
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 769-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000837
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number 4 Region: 905-933
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000222
Family CCCH zinc finger 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000004096
Domain Number - Region: 629-660
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0137
Family CCCH zinc finger 0.0072
Further Details:      
 
Domain Number - Region: 504-533
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0597
Family CCCH zinc finger 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000004096   Gene: ENSFALG00000003931   Transcript: ENSFALT00000004115
Sequence length 972
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603203.1:2334351:2358167:1 gene:ENSFALG00000003931 transcript:ENSFALT00000004115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVSEERSTRQQDIKKGLQFIESTLPYPGTQEQYELFIRDLVRNLFHEGNDVYREGDWR
GSLSHYTEAINIADYANSEEIHVSDDVLEKLHVNRIACFSNMGLHEKVLEDCEVALRLNE
NNFRALYRKAKALNELGSYKKAYDAVAKCSLAVPQDESVIKLTQELAQKLGLKIRKAYVR
AKPPSSNSVSSDVSTQNSSVEDIELDLSDQKQEMVSAASSSNFVSEVSKVSPVPVPPLPT
VMPLQMEKVPLPSTVLANGGNISFSMPEACLDCGDGDIIIGEELDELLDSVPDPDESVMQ
TTGARGPIPAGSVAPSVPFSASLLGTLPVTAGFVPSASLSEIFSQPLASSLENFCSPLST
FSISDPKRDVSSSASRDGTPALNSNNSPLFINGPSSLFGSENYMGIAGQARNDFSNVFSS
TTANIPVSPALVGRNPLEGTHELRQACQLCFVKKGPKLLDYAYHPNLEHKCKKDILIGRI
KNSEDKSWKKIRPRPTKTQYVGPYHICKDVAAEEECRYPGHCTFAYCQEEIDVWTLERKG
AFSREALFGGPGKINLTVSQLLQEYHGLFMFLCEKCFDHKPRIISKRNKDNSSSCSHPAM
HDFEDNKCLVHILRETMVKYSKIRPFQVRCQLDLCRHEVHYGCLREDKCFYAHSLVELKV
WIMQKESGISHDTIVQESKKYWQNMEASAHGSQILGNQMKYGSLNLKMKFVCGQCWRNGQ
VSEPDRNKKYCSAKARHPWSKDRRVVLVMSNERKKWMTIRPLPAKKQVPLQFDLCNHIAS
GKKCQYDGNCSFAHSPEEREMWTYMKENSIQDLEQLYDIWLKTQKPEKIGDDTAAQANKE
NGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQNCWQYRF
PTGYFSICDRYMAGTCTEGNNCKFAHGNAELREWEERRQVLRMKLSKARKDHLIAPSDND
FGKYSFLFKDLN
Download sequence
Identical sequences U3JMU2
ENSFALP00000004096 XP_005054118.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]