SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000004574 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000004574
Domain Number 1 Region: 297-430
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-32
Family C-type lectin domain 0.00059
Further Details:      
 
Domain Number 2 Region: 145-287
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-31
Family C-type lectin domain 0.00089
Further Details:      
 
Domain Number 3 Region: 1178-1306
Classification Level Classification E-value
Superfamily C-type lectin-like 1.55e-31
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 4 Region: 738-869
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-30
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 5 Region: 1043-1163
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-28
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 6 Region: 437-575
Classification Level Classification E-value
Superfamily C-type lectin-like 1.56e-26
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 7 Region: 593-739
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-25
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 8 Region: 886-1026
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-22
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 9 Region: 93-149
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-17
Family Fibronectin type II module 0.0015
Further Details:      
 
Domain Number 10 Region: 1-93
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000075
Family Cysteine rich domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000004574   Gene: ENSFALG00000004395   Transcript: ENSFALT00000004598
Sequence length 1389
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603264.1:2727709:2761059:-1 gene:ENSFALG00000004395 transcript:ENSFALT00000004598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWKWVSSRRLFNIGSSTCLGLNISNPEQPLAMLECDSTQYSLWWTCEGKELVGVSEYRL
AVENSKHIVAKKKSACQWKQYMSDDEDLCEHPFEETYTLLGNSFGFPCIFPFKYKNKWHY
ECTRDGKESEWCATTTHYEQDEKWGFCPNAESGCGTFWKKSPNTQVCYQFNVASVLSWRE
ARAACQLQGGDLLSVTSPEEQNYISDLSRQLNSTDVMLWMGLNRLDEDAGWQWSDGAPLV
FVNWRANVSDHRFKENLCAVINPRLKYGWNSYLCESGLPFVCKKYLNKTEHETLDTWKYS
ATRCGAGWYPHNRNCYRLHKEEKSWNDASLSCQSENSRLISISSMADEELLLNLLESENV
TETWIGLYSNNTPVVFEWSDSTPVKFSNWHRQEPNTFQRTGQLCVSAQGPEGRWRIKKCE
DKSFFICKKAGEFNTVSPELESSCPEGWERHGGYCYKIDSTPRSFEHASSGYFCPSALVS
VTNRFEQAFINSMIHSMAESERTYIWIGLQDLNNTGEYFWLGTAGKNRSVSYTNWSKYQP
RHSGGCVAMRGQHPVGYWEVKSCKNFKAMSLCKQKINSYEEPELTFQKYSSSCYFGWESE
PNLLNCYKIFHNEKVLMRRTWDEAEALCQDFGAHLASFSHIYEETFLNNLLYTIFDRTEE
RQFWIGFNKRNALSGGTWQWSDRTPVVSAFLEDKYVEDDSRNCGVFRVNRTVFPAHCSEK
REWICKIPKGVKPMNPVWYTAELPWSYYQGAEYLFHVSPAEWETSKFVCGWLRGGLAIIN
SSAEQTFIQNKIRKLSSSDVHWWIGLQAENLSDEFRWRDESPVTYQNWEEGRERDLQKPG
KRCGFISSQTGLWGDENCTVSLPCICKRKIPKKIEKEIPKDPNQQGACPKGWLHFGFKCF
LIQIPKDPEHLRSWYSAQEFCSNHDGSLAILEDELEQAFITMNLYGWKTSVWIGFQSDDY
EKQLNENPQRYSNWSPVEVVDREHFNIQDQLPLCTLVSNNPNFYFTGKWYLENCQKNYGF
VCQKTQDVSRHVINASDMYPVPDTLEYGNRMYKLISGNFTWSSALQACMANSAELVSITD
QYQQAFLTVIVSRLGYSHWIGLFTANNGLNFEWSDGTRSLFTFWEDDESQAFGSCVYIDT
SGRWKSANCEQFLQGAVCHVPPKKKLNAYKGLCSEKTVPWIKFKNSCYSFSTVLQGMSFE
TAYEVCKNQGSNLLTIQDEDENAFILEELHNFGYSVQMVWLNILLVTDNETVSWFDGSPL
NYSNWGIREPEFDNLKGNFCISLRTTDGVWQLSPCREKRGFVCKMDADTDTTESSEKASY
SGLAALAVLVTLVMLAAISLFLWCLHRENNQLFRRILWVRDAYLPQINADSPALEESILI
SDFEKSEDN
Download sequence
Identical sequences U3JP70
XP_016155435.1.66865 ENSFALP00000004574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]