SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000004661 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000004661
Domain Number 1 Region: 492-792
Classification Level Classification E-value
Superfamily L domain-like 7.14e-49
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 880-1036
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-37
Family Toll/Interleukin receptor TIR domain 0.0000479
Further Details:      
 
Domain Number 3 Region: 23-429
Classification Level Classification E-value
Superfamily L domain-like 3.4e-36
Family Ngr ectodomain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000004661   Gene: ENSFALG00000004472   Transcript: ENSFALT00000004685
Sequence length 1047
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603194.1:6186247:6199549:-1 gene:ENSFALG00000004472 transcript:ENSFALT00000004685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPRAKMSNALPFILLFIFPMLLSGAWFPKTLPCDVKSSEGTVTVDCTDRRLTEVPRGIP
GNATNLTLSINHIPHIYPTTFNHLESLEEIDFRCNCVPVKLGPKDRVCSSPLKIENGSFA
ALTSLRSLYLDANQLAEIPRGLPATLSLLSLEANSIFSIQEASFSELGNIEALYLGQNCY
YRNPCNVSFEIEKTAFLGLKKLTILSLKSDNLTQIPPNLSSTLRELYIYNNMIQEIQEED
LSGVPNLEILDLSGNCPRCYNAPYPCIPCPKSSIQIHSKAFDSLENLRILRLHSNSLQSI
PSSWFKNMKNLQELDLSQNFLMREIGDAQFLTFIPSLVQLDLSFNFQLKMYSPYLNLSKT
FSSLSNLETLRLKGYVFKELRARDLRPLLSLRNLTMLDLGTNFIKIANLTVFEEFPALKF
IDLSVNKISPSSGESNLHGFCSSPGISVERYNGQVQQEMHYFRYDLYERSCRSKDKEASS
YKPLVKEDCLNYGKTLDLSRNNVFFVNPSDFQGFSSLKCLNLSGNAISQTLNGSEFSYLT
GLKYLDFSNNRVDLLYQTAFKELKHLEILDLSNNQHYFLAEGVSHVLSFMKNLAHLRKLM
MNENEISTTIDTGMESKSLRILEFRGNRLDALWMDGNARYLSFFENLTSLEELDISFNSL
SFLQHGVFEKMPPSLRILNLTNNQLKSFIWGNLPSLRNLVTLDLSNNLLTNVPRELSNCT
SSLQQLMLRNNRIHRLTKYFLRGAFELRYLDLSSNKIEVIKRSSFPENVINNLKMLLLHG
NPFKCNCEAVWFVWWINRTQVTIPLLATDVTCAGPGAHKGRSVVFLDLYTCELDTSYLIL
YALSASAVLGLMVFTVMSHLYFWDVWYSYHYCTAKLKGYRRLSSPDACYDAFVAYDSEDA
AVNEWVLQELVERLENQKARQFNLCLEGRDWLPGQPVFDNLSQSIQLSKKTIFVLTKRYI
KSGRFKTTFYMAHQRLLDEKMDVIILVFLEKVLQKSRYVRLRKRLCRSSVLEWPTNPQSQ
PYFWQCLRNAIATSNSLAYNKLLKETV
Download sequence
Identical sequences U3JPF7
ENSFALP00000004661 XP_005037457.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]