SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000005127 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000005127
Domain Number 1 Region: 278-413
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.35e-51
Family ets domain 0.00000277
Further Details:      
 
Domain Number 2 Region: 98-196
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.34e-28
Family Pointed domain 0.000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000005127   Gene: ENSFALG00000004929   Transcript: ENSFALT00000005152
Sequence length 452
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603225.1:722346:807838:-1 gene:ENSFALG00000004929 transcript:ENSFALT00000005152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTIKEALSVVSDDQSLFDPTYGAAAQLPKDMTASGSPDFGQPHKINPLPPQQEWINQP
VRVSVKREYDHMNGSRESPVDCSVSKCGKLVGAGSESTPMSYSTYMDEKNGPPPNMTTNE
RRVIVPADPTLWTQDHVRQWLEWAIKEYGLMEIDTSIFQNMDGKELCKMNKDDFLRTTSP
YNTEILLSHLSYLRESSSLLVYNTPSHTDSSRLATKEDPSYDAVRRAGWGSNGNSGLSKS
PPVAGTQNVNKTTEQQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNASCI
TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPTESSMYKYPSDLSYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS
PYWTSPAGSIYPNPSVPRHPNAHVTPHLGSYY
Download sequence
Identical sequences U3JQS3
ENSFALP00000005127 XP_005058722.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]