SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006019 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006019
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 5.89e-89
Family Subtilases 0.0000000273
Further Details:      
 
Domain Number 2 Region: 474-619
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-35
Family Proprotein convertase P-domain 0.00074
Further Details:      
 
Domain Number 3 Region: 58-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000901
Family Prohormone convertase 1 pro-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006019   Gene: ENSFALG00000005742   Transcript: ENSFALT00000006046
Sequence length 738
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603405.1:290211:305240:-1 gene:ENSFALG00000005742 transcript:ENSFALT00000006046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHWRRAAPLWSAGMEATLCIHTCLWLSAAWIPLASPAGPTSGGQRAPDTEARHGKLTWA
VSLDAPEEELEQRAEELARTAGLVNMGRVGELKGHYLFAYQPDGQTATEHEAIRRSVDTL
FAQHNSVRWHSEQKLLKRSKRCLRFNDPKYPQQWHLNNRKSPGKDINVTGVWERNVTGRG
VTVVVVDDGVEHTIKDIQPNYSPEGSYDLNSNDPDPMPHPDEENGNHHGTRCAGEIAAVP
NNSFCTVGVAYGSRIAGIRVLDGPLTDSMEAIAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRRGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDETGSM
PFYAEECASMLAVTFSGGDKMMRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHVIVFTATKYEDRHARWDTNQAGFSHSHQHGFGLLNAWRLVNAAKIWE
SVPYLASYMSPVLKEGRSIPVLPQELEVAWNVTPADLELSGMRTLEHVAVTVTITHPRRG
NLEVRLLCPSGMMSVIGTARSMDSDPNGFSDWTFSTVRCWGEEAQGTYRLLVRDIGDESL
RPGTLKHWQLTLYGSSWSPAEIKERQRLLEEAMSGQYLSGDFSLPCPPGLDIPEEQRYTI
TANTLKTLLLLGCFVVFWTLYYMLEVCLSRNEVGLDLACSSNCRWYQQGGKHRALESSLE
MESVPLYQEKDVEEAETE
Download sequence
Identical sequences U3JTB5
ENSFALP00000006019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]