SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006173 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006173
Domain Number 1 Region: 70-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.97e-52
Family Astacin 0.00011
Further Details:      
 
Domain Number 2 Region: 427-597
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-38
Family MATH domain 0.00061
Further Details:      
 
Domain Number 3 Region: 267-430
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-32
Family MAM domain 0.00092
Further Details:      
 
Domain Number 4 Region: 638-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000138
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006173   Gene: ENSFALG00000005911   Transcript: ENSFALT00000006200
Sequence length 732
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603182.1:3060970:3082845:-1 gene:ENSFALG00000005911 transcript:ENSFALT00000006200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQEQDWLNYLLGTLSFFLSPPQPAPETTEIDVDGGIDQDIFDINEALGLDLFEGDIKLPG
VQERNSIIGDNYRWPHVIPYVLMDSLEMNAKGLILKAFEQYRLKTCIDFKPWEGEKNYIS
VFKGNGCWSSVGNMQMGLQQLSIGANCDRIGTIEHEFLHALGFWHEQSRSDRDDYVTIVW
DRIQYGKEHNFNKYDDRRSDFLNVPYDYNSVMHYSKTAFRNGTEPTIITNIPDFLDVIGQ
RMDFSEYDLQKLNKLYNCTSSLSFMDTCSFELENICGMIQSSADNGDWQRLSQVPAGPNT
DHTNMGKCKDSGYFMHFNTSSGGEGSTAALESRIFYPKRGFQCLQFYLYNSGNENDQLNV
WVREYTSANPNGTLRFIEEIKGSPETYWQLHHVSLNVTSKFRVVFEGVRGSGLSNGGLSI
DDINLSETQCPHHIWHIRNFTHLLNTSPAGSNGTIYSPPFYSSKGYAFQVSLYVNGTTDN
PFNLGIYLSLVSGANDAHLEWPCPWQQVTMILLDQHPDIRQQMSNQRSITTDPQRLSGSS
SNFTWDRPDEVGSEATYPNGTKYMRGPGVGTSAFLTHQRLRSRNFIKEDGVYILLTMEDI
SHLLSTQPSTPPPVTTTSASPTTTGHTTQPTDPEVPALCPNNPCENDGVCVLVNRAPVCR
CPAGDNWWYMGERCERKGSTRENTVIAVSSTLTVFVVMLIVTITTAVCLKKKYKQGKENI
HSLALEETKTSF
Download sequence
Identical sequences U3JTR9
ENSFALP00000006173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]