SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006257 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006257
Domain Number 1 Region: 320-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000135
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 2 Region: 588-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000744
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 59-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000369
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 4 Region: 368-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000246
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 458-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000174
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 651-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000924
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 404-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000524
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000006257
Domain Number - Region: 115-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00211
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006257   Gene: ENSFALG00000005991   Transcript: ENSFALT00000006285
Sequence length 773
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603360.1:1132529:1160168:-1 gene:ENSFALG00000005991 transcript:ENSFALT00000006285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSYTCKGGRKTAGSNKPTASKESRTETRINPPAELPKLGNATSDKTEGRKKGRPKAEN
QALKDIPLPLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISEKLTYS
CSYCEAAFSSKTQLEKHRLWNHLDRPVPTSKAENKVPKAIGKSSGKKRPAESSACPTIHP
KQAKMEKAVAQEHAENGECLAESRESKEFQIAAAEAMTAATPTAKSSSGKDAGQQRGSQA
LLQEEDPERMKHRRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKAKAHRAKKLEGNANME
ELKKKPPGVGVKKETSVHPPAAANPEDQWQREISEKGEVSCPTCSIITRKTIVGLKKHMD
VCQKLQDALKCQHCKKQFKSKAGLNYHTMAEHVSKPVPVETAGLGEQEERERLRKVLKQM
GKLKCPNEGCVANFSSLMGYQYHQKRCGKQLAEADKPVFSCPHCGKKYKSKAGHDYHMRS
EHPASVSAPDACAARGAGPYPPGGDCRAAEPVGRTEPAKAGPGKPPEEPEVKPEPAPVED
FERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETKRLNYTRPGLPKLN
PRLLENWKNEVKEKGRINCPNNCCEAIYSSVSGLKAHLANCNKGDHSVGKYRCLLCQKEF
SSESGVKYHIIKAHSENWFRTSSEASRKKKNREQLSSSKEEKKKSTNGKKRGRKPKERPP
EMSPKGKESVAAKTNHKKTLEHWVGSRGSPEGDELVLKPPSQRKGGASKMPEK
Download sequence
Identical sequences U3JU06
ENSFALP00000006257 ENSFALP00000006260 XP_016158729.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]