SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006767 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006767
Domain Number 1 Region: 1034-1149
Classification Level Classification E-value
Superfamily SEA domain 3.27e-19
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 251-345
Classification Level Classification E-value
Superfamily SEA domain 0.00000000275
Family SEA domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000006767
Domain Number - Region: 1199-1241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0871
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006767   Gene: ENSFALG00000006484   Transcript: ENSFALT00000006796
Sequence length 1379
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603237.1:2996414:3046267:-1 gene:ENSFALG00000006484 transcript:ENSFALT00000006796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGFMWKIFLCLPGMINTDLQIAAAAGGGQAKDVSPAPQLSDWQLANPSLPPGLKKPNGI
MDAEQFHRHLQLRRKRSILFPSGVKICPDESVEQAIANHLKYFRLRVCQETVWEVFKTFW
DRLPEREEYNTWMSLCEEGMMSIFEMGTNFSQSEEHRSLIVKKLAYTKEAMGSSCADWSC
GGTPTPPLDADVTTLRDLDAAANVPPPDEVSIESPVGDTVQEHDHVDTTINNEIKQQDEK
LVKPVTEQMIEFNILIVSEQYSEELKDPSAAEYQQLSERFISQIKKVFEGLPGYKNIHIL
DYRISPSEEDRSGVEVHYAVTFDGKAISNATWDLINLHSNKVEDNSFMGIEDNPTVVYTI
SDFRDYIAEILQKNALLENASISLDPNSLQLTNVKEIQHPTSEDPSWITEHPVVLERPEF
DDSTFLAERPSADESTVSNALPFDYTKPDSTSDGEQPTDNEIQPRPENIDYEDGLAPEAP
LSSEVDVTSLPDGLNLETSHLATVPVLEHDSVDSLEWLSAPSSSDVFEDTGLSEELLPLS
PSHLVPEESPSTDDYAVPLLSEPTVASSSVVETDIKEKEEVMQGSPEGSDSADSLEEIPF
PLEVPPMEDETDIFLGDRVTYDDGSGSAFDGSGKEMESSIWPWEEATLEPVFYPGPDSWL
EDDNESLLIKTEDIPEGMILDYILNSGNKLDYDLSKDENEGKVNIKDFLDESEIFVFPET
TSPQVPLLQTEEPSSLEPSTQTETLGMYDSSFVMPTGEAPVSPPYTHLSVEDSLLTSPGT
VSMEQPEESSVGQNIIPEVVEHQGEDRAGAEEQFTVKQPDVMEAATIGHLDSLETILTAD
PSVVKPDASTEEEQALDASLADQDTPVSAVKEPADVWPTDRALETSLNQTVQPAMPVVTQ
GSAAGPADATTIPESFAGQDGADHDTHTTMSFSTVKDYQTVSVAASTVELPSHLPPVGSS
PSLSMATSTKLGDETTRVLDVSADLGHVSTVHFSPERTGEGRRMTESHMELTTRVQSTEM
ASVAWATHETHYSSTVPSRALVVFFSLRVTNMMFSEDLFNKNSPEYKALEQRFLELLVPY
LQSNLTGFQNLEILNFRNGSIVVNSRMKFAKPVPRNVTNAVYMILEDFCNTAYHTMNLAI
DKYSLDVESGEQADPCKFQACNEFSECLVNRWSGEAECVCNPGYLSIDGLPCNSICDLQP
NFCLNDGKCDISPGQGAICRCRVGENWWYRGEHCEEYVSEPLVVGIAIASVAGFLLVASA
VIFFLARTLRDQYTKSDTGDSQGQGDSLSSIENAVKYNPMYESDTTGYSHYYRRYPQLTS
YSSTSAETSTDYSSEEIRHIYENSELTKEEIQDRIRIIELYAKDRQFAEFVRQHQMKLL
Download sequence
Identical sequences U3JVG3
ENSFALP00000006767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]