SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006800 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006800
Domain Number 1 Region: 1071-1137
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.29e-16
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000006800
Domain Number - Region: 21-54
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000142
Family PDZ domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006800   Gene: ENSFALG00000006515   Transcript: ENSFALT00000006829
Sequence length 1139
Comment pep:novel scaffold:FicAlb_1.4:JH603605.1:4014:59662:1 gene:ENSFALG00000006515 transcript:ENSFALT00000006829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVGLGWELGMRQEGFLGTQVNGVNVVKVGHKQVVALIRQGGNHLLMKVVSVSRKPEVE
EGGRKKAPPPPKRAPSTTLTLRSKSMTAELEELAFQASMRRRKGEKLDEILAAAEPALRA
ELVEADSRAATVKRRKSHQDMAAGNEGESLFERQGMAHPGVLAGTEKPHVSLRKGIPRTK
NSLDVIFNSGIWEDEKLAASLLDGKFPRSTSMTDTVREGHGIPPPPXSPPPPPGRAYDTI
RSSFKPGLEAKLHGLPQVLSAAEMYDQARGSMPYPERQKRARSMIILQDSSHLPVEPTEI
PRPGPAVTPPEKLKRKGRVIDNPYANMGQFNVSLFAPTKPQRKKSPLVKQLQVEDAQERA
ALAITGGYSSREPSPTRRSHRLEYQHHPGIAQVEAAGLPFATAIAAGVMKDRDRRLDERR
KSTVFLSVGAIEGPAPGGSEMPSLQQSRSIDERLLGSRDVLLPSPVTTPGTPVSHLAAPG
APSLPAAAVAPSPPGATPSGKPSDAPAAPESAADSSSSSTFIHPLTGKPLDPNSPLALAL
AARERALSTQVPSRSPTPIHSPDSDRAAPLFVDRKAVMAADAGALTPTKSPWGTPTTLRK
EPEVRAETPGKEEKKPEDKKSMIISIVDTSQQKTAGLIMVHATSNGQDEIGLEIKEESPA
VPEVCAEPVESPKAEPQPSPVGKPPASPASEKALGQGSSEEEVEPYTVTLPPAQLSSSDE
ETREELAKIGLVPPPDEFANGVLVTTPGTPVSHLAAPGAPSLPAAAVAPSPPGATPSGKP
SDAPAAPESAADSGVEEVDTRSSSDHHLETTSTISTVSSMSTLSSESGEPTDTYTSFADG
QTFLLEKPPVPPKPKLKSQLSKGPVTFRDPLLKQSSDSELISQHHAATLAATSAARPRYL
FQRRSKLWGDPMESRPGHGAEEDKPTVISELSSRLQQLNKDTRSLGEEPAGSALDPGKKS
PVVAARSLGELSTISQRSSGTTFTVRPGSRYPVTRRTPSPVKPAALERPEPLSTVRPYGL
TPPTILKSSSLSIPHEPKEVRFVVRSVSARSRPPPPPPPPPPPPPPPPPPKPLHLWNKYD
VGDWLESINLVEHRDKFEDHEIEGTHLPALTKEDFVELGVTRVGHRMNIERALKQLVDS
Download sequence
Identical sequences U3JVJ6
ENSFALP00000006800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]